Report for 4926.m00068

 > 4926.m00068, length: 767, copies: 1 

MAGNVIRLELSEASLGGQVLQGRMSPSLASLEHLEYLDLSALVLPGINSSSPKFLGSMTNLRYLDLSGCFLSGSV

SPWLGNLSKLEYLDLSFSTLSGRVPPELGNLTRLKHLDLGNMQHMYSADISWITHLRSLEYLDMSLVNLLNTIPS

LEVLNLVKFTLPSTPQALAQLNLTKLVQLDLSSNRLGHPIQSCWFWNLTSIESLELSETFLHGPFPTALGSFTAL

QWLGFSDNGNAATLLADMRSLCSMKSLGLGGSLSHGNIEDLVDRLPHGITRDKPAQEGNFTSLSYLDLSDNHLAG

IIPSDIAYTIPSLCHLDLSRNNLTGPIPIIENSSLSELILRSNQLTGQIPKLDRKIEVMDISINLLSGPLPIDIG

SPNLLALILSSNYLIGRIPESVCESQSMIIVDLSNNFLEGAFPKCFQMQRLIFLLLSHNSFSAKLPSFLRNSNLL

SYVDLSWNKFSGTLPQWIGHMVNLHFLHLSHNMFYGHIPIKITNLKNLHYFSLAANNISGAIPRCLSKLTMMIGK

QSTIIEIDWFHAYFDVVDGSLGRIFSVVMKHQEQQYGDSILDVVGIDLSLNSLTGGIPDEITSLKRLLSLNLSWN

QLSGEIVEKIGAMNSLESLDLSRNKFSGEIPPSLANLAYLSYLDLSYNNLTGRIPRGSQLDTLYAENPHIYDGNN

GLYGPPLQRNCLGSELPKNSSQIMSKNVSDELMFYFGLGSGFTVGLWVVFCVVLFKKTWRIALFRLFDRIHDKVY

VFVAITWASIGREATTD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	60	83	0.0019
LRR [Pfam ls]	84	107	0.011
LRR [Pfam ls]	175	199	0.32
LRR [Pfam ls]	287	310	0.99
LRR [Pfam ls]	312	333	4.1
LRR [Pfam ls]	473	496	0.33
LRR [Pfam ls]	497	520	4.1
LRR [Pfam ls]	591	614	5.1
LRR [Pfam ls]	615	638	0.0012
LRR [Pfam ls]	639	661	0.98

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	33	56	1.4
LRR [sensitive, ls]	33	56	15
LRR [sensitive, ls]	60	83	0.00017
LRR [sensitive, ls]	60	83	0.0019
LRR [sensitive, ls]	84	107	0.001
LRR [sensitive, ls]	84	107	0.011
LRR [sensitive, ls]	108	132	7.3
LRR [sensitive, ls]	108	132	80
LRR [sensitive, ls]	133	155	3.5
LRR [sensitive, ls]	133	155	38
LRR [sensitive, ls]	175	199	0.03
LRR [sensitive, ls]	175	199	0.32
LRR [sensitive, ls]	200	223	0.75
LRR [sensitive, ls]	200	223	8.3
LRR [sensitive, ls]	287	310	0.09
LRR [sensitive, ls]	287	310	0.99
LRR [sensitive, ls]	312	333	0.37
LRR [sensitive, ls]	312	333	4.1
LRR [sensitive, ls]	334	356	1.4
LRR [sensitive, ls]	334	356	16
LRR [sensitive, ls]	378	401	2.5
LRR [sensitive, ls]	378	401	28
LRR [sensitive, ls]	402	424	2.5
LRR [sensitive, ls]	402	424	28
LRR [sensitive, ls]	425	448	0.61
LRR [sensitive, ls]	425	448	6.7
LRR [sensitive, ls]	449	472	0.82
LRR [sensitive, ls]	449	472	9
LRR [sensitive, ls]	473	496	0.03
LRR [sensitive, ls]	473	496	0.33
LRR [sensitive, ls]	497	520	0.37
LRR [sensitive, ls]	497	520	4.1
LRR [sensitive, ls]	567	590	1.1
LRR [sensitive, ls]	567	590	13
LRR [sensitive, ls]	591	614	0.47
LRR [sensitive, ls]	591	614	5.1
LRR [sensitive, ls]	615	638	0.00011
LRR [sensitive, ls]	615	638	0.0012
LRR [sensitive, ls]	639	661	0.09
LRR [sensitive, ls]	639	661	0.98

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	3	725	5e-69
CLV2 [A. thaliana]	3	730	5e-49
FLS2 [A.thaliana]	3	679	2e-60
Xa21 [O. sativa]	5	680	3e-41
FLS2 [A.thaliana]	9	679	2e-69
Xa21 [O. sativa]	19	631	3e-42
Xa21 [O. sativa]	172	655	4e-43
FLS2 [A.thaliana]	256	657	8e-36
Xa21 [O. sativa]	425	702	5e-17
Xa21 [O. sativa]	568	731	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	708	730	out -> in

Report for 4926.m00068

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)