Report for 4969.m00148

 > 4969.m00148, length: 1019, copies: 1 

MAVYNILILFLLLLLFSLSTAQPSADEQKLLLAIKQDWDNPAPLSSWSSTGNWTGVISSSTGQVTGLSLPSLHIA

RPIPASVCSLKNLTYIDLSCNNLTGDFPTVLYGCSALEFLDLSNNQLSGRLPDRIDRLSLGMQHLNLSSNAFTGD

VPSAIARFSKLKSLVLDTNRFNGNYPGAAIGGLVELETLTLASNPFEPGPVPKEFGKLTKLKMLWLSWMNLTGTI

PDDLSSLMELTLLDLSQNKMQGQIPEWVLKHQKLENLYLYASNLSGEIGPNITALNLQELDLSMNKFSGSIPEDI

ANLKKLRLLYLYYNNLTGPIPAGVGMMPDLTDIRLFNNKLSGPLPAELGKHSELGNFEVSNNNLSGELPDTLCFN

KKLFDIVVFNNSFSGVFPTNLGDCKTINNIMAYNNHFVGDFPKKIWSFELLTNVMIYNNNFTGTLPSEISFNISR

IEMENNRFSGALPSTAVGLKSFTAENNQFSGELPADMSRLANLTELNLAGNQLSGSIPPSIKSLTSLTSLNLSRN

QISGEIPAAVGWMGLYILDLSDNGLTGDIPQDFSNLHLNFLNLSSNQLSGEVPETLQNGAYDRSFLGNHGLCATV

NTNMNLPACPHQSHNKSSTNLIIVFSVLTGVVFIGAVAIWLLIIRHQKRQQDLAGWKMTPFRTLHFSECDVLGNL

HEENVIGSGGSGKVYRINIGGKGSDGMVVAVKRLWRTAAKSDAKSDKEFDAEVRILGEVSHINIIDLLCCISGDD

TKLLVYEYMENGSLDRWLHRRDDGGAPTAPLQWPTRLCIAIDAARGLSYMHHECAQPIMHRDVKSSNILLDPAFR

AKIADFGLARILAKSGEPNSISAIGGTFGYMAPEYGCRAKVNEKVDVYAFGVVLLELTTGRVANDGGADWCLAEW

AWRRYKAGGELHDVVDEAIQDRAAFLEDAVAVFLLGMICTGDDPASRPTMKEVLEQLVQYDRTSSVAAACRDDSG

GAPSLSKGKKDGKGKSSSAGTTAGKMWGAGTGDEESGSFVAHPV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	87	110	0.054
LRR [Pfam ls]	111	134	0.06
LRR [Pfam ls]	136	159	2
LRR [Pfam ls]	185	209	7.5
LRR [Pfam ls]	210	233	6.1
LRR [Pfam ls]	234	255	4.9
LRR [Pfam ls]	281	304	0.016
LRR [Pfam ls]	305	328	0.66
LRR [Pfam fs]	492	515	3.4e-05
LRR [Pfam ls]	492	515	0.00056
LRR [Pfam ls]	516	536	2.1
LRR [Pfam ls]	539	559	1.9
LRR [Pfam ls]	562	582	3
Ser/Thr pkinase [Pfam fs]	675	892	6.6e-45
Ser/Thr pkinase [Pfam ls]	675	959	1.3e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	87	110	0.0026
LRR [sensitive, ls]	87	110	0.054
LRR [sensitive, ls]	111	134	0.0029
LRR [sensitive, ls]	111	134	0.06
LRR [sensitive, ls]	136	159	0.095
LRR [sensitive, ls]	136	159	2
LRR [sensitive, ls]	160	184	2.6
LRR [sensitive, ls]	160	184	53
LRR [sensitive, ls]	185	209	0.36
LRR [sensitive, ls]	185	209	7.5
LRR [sensitive, ls]	210	233	0.3
LRR [sensitive, ls]	210	233	6.1
LRR [sensitive, ls]	234	255	0.24
LRR [sensitive, ls]	234	255	4.9
LRR [sensitive, ls]	258	278	0.74
LRR [sensitive, ls]	258	278	15
LRR [sensitive, ls]	281	304	0.00078
LRR [sensitive, ls]	281	304	0.016
LRR [sensitive, ls]	305	328	0.032
LRR [sensitive, ls]	305	328	0.66
LRR [sensitive, ls]	329	352	1.3
LRR [sensitive, ls]	329	352	27
LRR [sensitive, ls]	353	377	1.3
LRR [sensitive, ls]	353	377	28
LRR [sensitive, ls]	425	449	1.1
LRR [sensitive, ls]	425	449	22
LRR [sensitive, ls]	468	491	4.1
LRR [sensitive, ls]	468	491	85
LRR [sensitive, ls]	492	515	2.7e-05
LRR [sensitive, ls]	492	515	0.00056
LRR [sensitive, ls]	516	536	0.1
LRR [sensitive, ls]	516	536	2.1
LRR [sensitive, ls]	539	559	0.092
LRR [sensitive, ls]	539	559	1.9
LRR [sensitive, ls]	562	582	0.14
LRR [sensitive, ls]	562	582	3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	7	644	1e-58
FLS2 [A.thaliana]	7	581	9e-67
Xa21 [O. sativa]	7	769	2e-74
Cf-9 [L. pimpinellifolium]	12	581	2e-44
Cf-9 [L. pimpinellifolium]	49	556	1e-44
FLS2 [A.thaliana]	52	959	1e-112
Cf-9 [L. pimpinellifolium]	58	596	3e-49
FLS2 [A.thaliana]	221	583	2e-51
Pto [L. esculentum]	670	957	1e-34
Rpg1 [Hordeum vulgare]	671	961	8e-16
Rpg1 [Hordeum vulgare]	677	957	2e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	2	21	in -> out
putative TM domain	622	644	out -> in

Report for 4969.m00148

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)