Report for 4969.m00153

 > 4969.m00153, length: 534, copies: 1 

MVGAIAGSRPGGEVGNMEAMLLHRFIPQISSIVAANASTDELQCRLEETMLGIIRHDNIVVLRGSIQSDDDDGTV

QLVYEDMENGCCLHEWLHGNRRSQLEAGERQRRRRLRWRARRSIAVDVARAICYLHHDCKSPIIHRDIKPTNILL

DGNLKAKIAGFGLARINVAGLNQPLLNVEIPSEAFGYTAPEYATAQRGYGRHLSKDVVDKEIVPDMARYLKEMKA

MFKLGIGCRNGQVTSLSFHNFQIANLIPASICSLKNLKYLDLSFNNLTGEFPTALYSCSALQFLDLSNNEFTGKL

PEHVDKLSLGMQHLNLSRNSFIGDLPSAIGRFSKLKSLVLDSNNFNGTYQGAAIGGLVELEMLTLAYNPFKASLI

PNEFGKLTKLTYLWLSWMNLIGNIPNVLSALTELELLDISINKLEGKNPKELDLSINKLTGSIPEDIVNLKNLKI

LYLYYNNLVGQIPSGVGMLPNLTDLRLFTCHGVFPVSLGDCDTIHIIKASNNHFVGDFPEKIWSCAMLTIVMIGG

NNFTGTLPS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam ls]	8	265	1.6e-08
Ser/Thr pkinase [Pfam fs]	54	165	1.5e-17
LRR [Pfam ls]	261	284	0.028
LRR [Pfam ls]	285	308	0.029
LRR [Pfam ls]	310	333	2.8
LRR [Pfam ls]	359	383	2.6
LRR [Pfam ls]	384	407	8.3
LRR [Pfam ls]	423	446	0.21
LRR [Pfam ls]	447	470	0.28

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	261	284	0.0013
LRR [sensitive, ls]	261	284	0.028
LRR [sensitive, ls]	285	308	0.0014
LRR [sensitive, ls]	285	308	0.029
LRR [sensitive, ls]	310	333	0.13
LRR [sensitive, ls]	310	333	2.8
LRR [sensitive, ls]	334	358	1.2
LRR [sensitive, ls]	334	358	25
LRR [sensitive, ls]	359	383	0.13
LRR [sensitive, ls]	359	383	2.6
LRR [sensitive, ls]	384	407	0.4
LRR [sensitive, ls]	384	407	8.3
LRR [sensitive, ls]	423	446	0.0099
LRR [sensitive, ls]	423	446	0.21
LRR [sensitive, ls]	447	470	0.013
LRR [sensitive, ls]	447	470	0.28

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	149	533	4e-34
Cf-9 [L. pimpinellifolium]	208	533	6e-22
Xa21 [O. sativa]	219	533	2e-24
CLV2 [A. thaliana]	230	533	2e-30
FLS2 [A.thaliana]	230	534	1e-37
CLV2 [A. thaliana]	231	470	9e-19
FLS2 [A.thaliana]	233	533	1e-25
Cf-9 [L. pimpinellifolium]	234	465	4e-16
Cf-9 [L. pimpinellifolium]	235	512	5e-21
Cf-9 [L. pimpinellifolium]	235	534	7e-21
Cf-9 [L. pimpinellifolium]	235	534	2e-18
Xa21 [O. sativa]	235	510	1e-24
Xa21 [O. sativa]	236	533	7e-23
FLS2 [A.thaliana]	237	534	1e-32
Cf-9 [L. pimpinellifolium]	238	533	1e-17
Xa21 [O. sativa]	238	533	2e-28
Xa21 [O. sativa]	240	534	4e-25
FLS2 [A.thaliana]	241	475	5e-25
Xa21 [O. sativa]	241	491	2e-13
CLV2 [A. thaliana]	252	534	2e-29
CLV2 [A. thaliana]	252	511	8e-17
Xa21 [O. sativa]	265	534	1e-27
Xa21 [O. sativa]	384	534	2e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4969.m00153

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)