Report for 4969.m00156

 > 4969.m00156, length: 1004, copies: 1 

MTNSTDNLLLLLLLFFSGSSAELDDGGELQTLLTIKRHWGRPAAFSSWEVRSSNSFGYCDWVGVACTDGQVTSLS

FQSFQIANPIPASICSLKNLKYLDLSYNNLTGDFPTVLYNCSALQFLDLSNNELTGSLPSNIDKLSLGMQHLNLS

SNYFIGDVPSAIARFLKLKSLVLDTNSFNGSYPGASIGGLVELEILTLASNPFMPGPIPNEFSKLTKLTYLWLSW

MNLTGDIPDALSALKELILLDLSKNKMQGKIPKWIWKLQKLEMLYLFASNFSGEIGPYISTLNMQELDLSMNKLT

GSIPEDIANLKNLRLLYLYYNNLTGSIPKGVSMLPNLTDIRLFNNKLSGPLPPELGKYSELGNFEVSNNNLSGEL

PDTLCFNKKLYDLVVFNNSFSGVFPMNLGDCDTINNIMAYNNHFVGDFPENIWSFAKLINIMIYNNNFTGNLPSE

ISFNITRIEIGNNMFSGALPSAAIALKNFMAENNQFSGALPDDMSRFANLTELDLAGNRLSGLIPPSMQSLTKLT

SLNLSSNQISGEIPAVLGLMDLNILDLSNNKLTGHIPQEFNDLHVNFLNLSSNQLSGEVPAALQTLAYEDSFLDN

PSLCCQSESGMHIRTCPWSQSMSHDHLALSIRAILVILPCITLASVAITGWLLLLRRKKGPQDVTSWKMTQFRTI

DFTEHDIVSNISECNVIGRGGSGKVYRIHLGGDIKAGRHGGGCTPRTVAVKRIGNTSKLDTNLDKEFESEVRTLG

DLRHSNIVDLLCCISSQETKLLVYEHMENGSLDQWLQRYKRAGKSGPLDWPTRVAIAIDVARGLSYMHEDFVQPV

IHRDVKCSNILLDREFRAKIADFGLARILAKSGESESASAVCGTFGYIAPEYAYRSKVSVKVDVYSFGVVLLELA

TGRGPQDGGTESGSCLAKWASKRYNNGGPVADLVDGEIQDPSYLDDMVAVFELGVVCTSEEPASRPPMSDVLHRL

MQFDHSGTHSDGVVAKGVFDIDDSSDCIV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	94	117	0.012
LRR [Pfam ls]	118	141	0.0054
LRR [Pfam ls]	217	240	0.52
LRR [Pfam ls]	241	264	5.2
LRR [Pfam ls]	288	311	0.038
LRR [Pfam ls]	312	335	0.013
LRR [Pfam ls]	336	359	7.9
LRR [Pfam ls]	499	522	0.0036
LRR [Pfam ls]	523	543	0.16
LRR [Pfam ls]	546	566	1.7
LRR [Pfam ls]	569	592	1.4
Ser/Thr pkinase [Pfam fs]	686	908	1.3e-49
Ser/Thr pkinase [Pfam ls]	686	977	6.3e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	117	0.00056
LRR [sensitive, ls]	94	117	0.012
LRR [sensitive, ls]	118	141	0.00026
LRR [sensitive, ls]	118	141	0.0054
LRR [sensitive, ls]	143	166	0.74
LRR [sensitive, ls]	143	166	15
LRR [sensitive, ls]	167	191	2.2
LRR [sensitive, ls]	167	191	45
LRR [sensitive, ls]	192	216	0.45
LRR [sensitive, ls]	192	216	9.4
LRR [sensitive, ls]	217	240	0.025
LRR [sensitive, ls]	217	240	0.52
LRR [sensitive, ls]	241	264	0.25
LRR [sensitive, ls]	241	264	5.2
LRR [sensitive, ls]	288	311	0.0018
LRR [sensitive, ls]	288	311	0.038
LRR [sensitive, ls]	312	335	0.00064
LRR [sensitive, ls]	312	335	0.013
LRR [sensitive, ls]	336	359	0.38
LRR [sensitive, ls]	336	359	7.9
LRR [sensitive, ls]	360	384	1.3
LRR [sensitive, ls]	360	384	28
LRR [sensitive, ls]	432	452	3.3
LRR [sensitive, ls]	432	452	69
LRR [sensitive, ls]	454	477	0.84
LRR [sensitive, ls]	454	477	18
LRR [sensitive, ls]	499	522	0.00017
LRR [sensitive, ls]	499	522	0.0036
LRR [sensitive, ls]	523	543	0.0075
LRR [sensitive, ls]	523	543	0.16
LRR [sensitive, ls]	546	566	0.082
LRR [sensitive, ls]	546	566	1.7
LRR [sensitive, ls]	569	592	0.067
LRR [sensitive, ls]	569	592	1.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	585	1e-67
Xa21 [O. sativa]	9	786	5e-74
Cf-9 [L. pimpinellifolium]	53	585	1e-45
CLV2 [A. thaliana]	60	607	4e-58
Cf-9 [L. pimpinellifolium]	67	593	7e-49
Cf-9 [L. pimpinellifolium]	71	627	6e-43
Cf-9 [L. pimpinellifolium]	71	376	8e-24
FLS2 [A.thaliana]	74	589	4e-69
FLS2 [A.thaliana]	85	977	1e-110
Cf-9 [L. pimpinellifolium]	93	563	2e-43
Cf-9 [L. pimpinellifolium]	95	330	2e-23
FLS2 [A.thaliana]	228	598	1e-49
FLS2 [A.thaliana]	285	601	3e-36
Cf-9 [L. pimpinellifolium]	292	591	2e-14
Rpg1 [Hordeum vulgare]	667	903	4e-26
Rpg1 [Hordeum vulgare]	680	979	8e-21
Pto [L. esculentum]	681	975	2e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	633	655	out -> in

Report for 4969.m00156

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)