Report for 4992.m00080

 > 4992.m00080, length: 496, copies: 1 

MTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKF

EGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPC

LIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMS

AFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGD

KKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQM

EALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVT

LSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQRVP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	15	39	5
LRR [Pfam ls]	132	156	0.1
LRR [Pfam ls]	181	204	2.2
LRR [Pfam ls]	205	228	7.4
LRR [Pfam ls]	258	282	1.1
LRR [Pfam ls]	350	373	4.7
LRR [Pfam ls]	374	397	6.3
LRR [Pfam ls]	398	420	3.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	15	39	0.25
LRR [sensitive, ls]	15	39	5
LRR [sensitive, ls]	42	62	7.1
LRR [sensitive, ls]	42	62	140
LRR [sensitive, ls]	64	85	0.73
LRR [sensitive, ls]	64	85	14
LRR [sensitive, ls]	132	156	0.0053
LRR [sensitive, ls]	132	156	0.1
LRR [sensitive, ls]	157	180	1.6
LRR [sensitive, ls]	157	180	31
LRR [sensitive, ls]	181	204	0.11
LRR [sensitive, ls]	181	204	2.2
LRR [sensitive, ls]	205	228	0.38
LRR [sensitive, ls]	205	228	7.4
LRR [sensitive, ls]	229	253	4.6
LRR [sensitive, ls]	229	253	90
LRR [sensitive, ls]	258	282	0.056
LRR [sensitive, ls]	258	282	1.1
LRR [sensitive, ls]	326	349	2.4
LRR [sensitive, ls]	326	349	47
LRR [sensitive, ls]	350	373	0.24
LRR [sensitive, ls]	350	373	4.7
LRR [sensitive, ls]	374	397	0.32
LRR [sensitive, ls]	374	397	6.3
LRR [sensitive, ls]	398	420	0.17
LRR [sensitive, ls]	398	420	3.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	435	1e-28
Xa21 [O. sativa]	12	414	2e-24
CLV2 [A. thaliana]	14	430	5e-24
CLV2 [A. thaliana]	15	437	7e-21
FLS2 [A.thaliana]	15	467	7e-26
CLV2 [A. thaliana]	19	450	1e-35
FLS2 [A.thaliana]	19	435	4e-26
Cf-9 [L. pimpinellifolium]	21	488	1e-66
FLS2 [A.thaliana]	64	435	9e-35
Cf-9 [L. pimpinellifolium]	65	447	1e-14
FLS2 [A.thaliana]	65	447	1e-21
CLV2 [A. thaliana]	94	475	3e-29
CLV2 [A. thaliana]	113	421	3e-14
Xa21 [O. sativa]	185	437	4e-11
FLS2 [A.thaliana]	189	436	8e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	459	481	out -> in

Report for 4992.m00080

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)