Report for 4992.m00083

 > 4992.m00083, length: 740, copies: 1 

MTSQTKMLLMLSLLLHLLIPSSSSATYTNHTGALPPAVPCLPDQASALLQLKRSFTITDDSTAAFRSWNAGKDCC

RWEGVSCGDADGRVIWLDLGDCGLESNSLDPVLFKLTSLEYLNLGGNDFNESEIPSAGFERLSQVPVQSIGQLHS

LVSLDISFSSDLIELFDHGYLINPWQMDLPNLTALVANLSSLRSLNVIDLQYNYLTGPIPEYFANLSSLSVLQLG

YNKLEGWVSPSIFQNKKLVTIDLHRNPDLSGTLPNISADSSLESLLVGRTNFSGRIPSSISNIKSLKKLDLGASG

FSGKLPSSIVRLDLSFNMFEGTIPLPQNSRFVLDYSNNRFSSIPTNISTQLGYTAYFKASRNNLSGEIPSSFCSN

NIQVLDLSYNFFSGSIPSCLFEDANALKVLNLKQNQLHGELAHNINESCTLEALDFNDNRIEGNLPRSLVSCRKL

EVLDIQNNQINDSFPCWMRVIPRLQVLILKSNKFFGQVTPTVAEESTCEFPSLRILDLASNNFSGTLSEAWFMRL

KSMMIESTNETLVMEFEGDQQVYQVNIVLTYKGSAIAISKILRTFVFIDVSNNAFHGSIPESIGELVLLHALNMS

HNSLTGPVPSPLGHLNQMEALDLSSNELSGVIPQELASLDFLGTLNLSYNMLEGKIPESPHFSLFSNSSFLGNDA

LCGPPLSKGCNNMTLLNVIPSQKKSVDVMLFLFSGIGFGLGFAIAIVIAWGFPIRRRSPARQRAL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	113	138	0.14
LRR [Pfam ls]	194	217	0.033
LRR [Pfam ls]	308	330	4.8
LRR [Pfam ls]	376	400	0.019
LRR [Pfam ls]	449	472	5.6
LRR [Pfam ls]	502	526	0.066
LRR [Pfam ls]	593	616	1.7
LRR [Pfam ls]	617	640	2.3
LRR [Pfam ls]	641	663	8.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	88	112	0.68
LRR [sensitive, ls]	88	112	13
LRR [sensitive, ls]	113	138	0.0073
LRR [sensitive, ls]	113	138	0.14
LRR [sensitive, ls]	194	217	0.0017
LRR [sensitive, ls]	194	217	0.033
LRR [sensitive, ls]	218	241	4.9
LRR [sensitive, ls]	218	241	96
LRR [sensitive, ls]	242	265	0.82
LRR [sensitive, ls]	242	265	16
LRR [sensitive, ls]	266	289	1.2
LRR [sensitive, ls]	266	289	24
LRR [sensitive, ls]	308	330	0.25
LRR [sensitive, ls]	308	330	4.8
LRR [sensitive, ls]	376	400	0.00094
LRR [sensitive, ls]	376	400	0.019
LRR [sensitive, ls]	401	421	4.7
LRR [sensitive, ls]	401	421	92
LRR [sensitive, ls]	425	448	0.52
LRR [sensitive, ls]	425	448	10
LRR [sensitive, ls]	449	472	0.28
LRR [sensitive, ls]	449	472	5.6
LRR [sensitive, ls]	473	501	3.6
LRR [sensitive, ls]	473	501	71
LRR [sensitive, ls]	502	526	0.0033
LRR [sensitive, ls]	502	526	0.066
LRR [sensitive, ls]	569	592	1.2
LRR [sensitive, ls]	569	592	23
LRR [sensitive, ls]	593	616	0.086
LRR [sensitive, ls]	593	616	1.7
LRR [sensitive, ls]	617	640	0.11
LRR [sensitive, ls]	617	640	2.3
LRR [sensitive, ls]	641	663	0.44
LRR [sensitive, ls]	641	663	8.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	33	658	1e-50
CLV2 [A. thaliana]	33	677	1e-53
Xa21 [O. sativa]	47	678	1e-45
FLS2 [A.thaliana]	75	678	1e-42
FLS2 [A.thaliana]	106	413	4e-13
Cf-9 [L. pimpinellifolium]	107	725	6e-80
FLS2 [A.thaliana]	131	678	4e-48
FLS2 [A.thaliana]	182	704	2e-40
CLV2 [A. thaliana]	188	680	9e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	707	729	out -> in

Report for 4992.m00083

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)