Report for 4992.m00086

 > 4992.m00086, length: 993, copies: 1 

MASTLPQLLLILLLLTLYCSIQTVANTTIPVHCHPHQAEALLQLKSSFINPNLSSWKLNTDCCHWEGVTCDTSSG

QVTALDLSYYNLQSPGGLDPAVFNLTTLRNLSLAGNDFNRTVLPSFGFQRLTKLLRLDLSEAGFFGQIPIGIAHL

KNLRALDLSFNYLFFQEPSFQTIVANLSNLRELYLDQVRITSEPTWSVALAHSLPLLQNLSLSQCDLGGTIHRSF

SQLRSLVVINLNYNGISGRVPEFFADFFFLSDLALSNNNFEGQFPTKIFQVENLRSLDVSFNPTLFVQLPDFPPG

KYLESLNLQRTNFSGNMPASFIHLKSLKFLGLSNVGSPKQVATFIPSLPSLDTLWLSGSGIEKPLLSWIGTIKLR

DLMLEGYNFSSPIPPWIRNCTSLESLVLFNCSFYGPIPSWIGNLTKLIYLELSLNSLSGRIPKLLFAHQSLEMLD

LRSNQLSGHLEDISDPFSSLLEFIDLSYNHLTGYIPKSFFDLRRLTNLVLQSNQLNDREDGYPFHYFPTIKYLGL

ASCNLTKIPGALRDIKDRLNLSSNRLHGNVPIPLTTTRDGGVLLDYSSNSFSSITRDFGSGMVPSCLIQNGDVTI

LKLRENNFHGVLPKNIREGCMFQTIDLNSNRIIGKLPRSLSKCKSLEVLDMGNNQILDSFPSWLGNMSNLRVLIL

RSNQFYGSVGLPTESDATSKYFSGLQIIDLASNNLSGSLQSKWFENLETMMINSDQGDVLGIQGIYKGLYQNNMI

VTFKGFDLMFTKILTTFKMIDLSNNDFNGAIPESIGKLIALHGLNMSRNSFTGRIPSKIGKLVQLESLDLSLNQL

SEAIPQELASLTSLAILNLSYNNLTGQIPQGPQFLSFGNRSFEGNAGLCGRPLSKQCNYSGIEAARSPSSSRDSA

SPRTRTRQKQRRTGEQRSSRINSLLQRIHDDRMITETCPDLQVATLQFQPVAFSLRRVASGSGPHWNWGLGIGVY

GRLVEWWWESKWGEASTR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	127	7.7
LRR [Pfam ls]	152	181	9.5
LRR [Pfam ls]	206	229	6.2
LRR [Pfam ls]	230	253	4
LRR [Pfam ls]	302	325	9.2
LRR [Pfam ls]	397	420	3.4
LRR [Pfam ls]	445	467	9.5
LRR [Pfam ls]	470	493	0.17
LRR [Pfam ls]	519	541	4.5
LRR [Pfam ls]	645	668	0.29
LRR [Pfam ls]	699	723	0.075
LRR [Pfam ls]	790	813	9
LRR [Pfam ls]	814	837	0.43
LRR [Pfam ls]	838	861	0.23

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	76	101	1.2
LRR [sensitive, ls]	76	101	25
LRR [sensitive, ls]	102	127	0.39
LRR [sensitive, ls]	102	127	7.7
LRR [sensitive, ls]	128	151	1.6
LRR [sensitive, ls]	128	151	31
LRR [sensitive, ls]	152	181	0.48
LRR [sensitive, ls]	152	181	9.5
LRR [sensitive, ls]	206	229	0.31
LRR [sensitive, ls]	206	229	6.2
LRR [sensitive, ls]	230	253	0.2
LRR [sensitive, ls]	230	253	4
LRR [sensitive, ls]	254	277	6.9
LRR [sensitive, ls]	254	277	140
LRR [sensitive, ls]	278	301	1.9
LRR [sensitive, ls]	278	301	38
LRR [sensitive, ls]	302	325	0.47
LRR [sensitive, ls]	302	325	9.2
LRR [sensitive, ls]	373	396	2.1
LRR [sensitive, ls]	373	396	41
LRR [sensitive, ls]	397	420	0.17
LRR [sensitive, ls]	397	420	3.4
LRR [sensitive, ls]	421	444	1.2
LRR [sensitive, ls]	421	444	25
LRR [sensitive, ls]	445	467	0.48
LRR [sensitive, ls]	445	467	9.5
LRR [sensitive, ls]	470	493	0.0088
LRR [sensitive, ls]	470	493	0.17
LRR [sensitive, ls]	519	541	0.23
LRR [sensitive, ls]	519	541	4.5
LRR [sensitive, ls]	621	644	1.3
LRR [sensitive, ls]	621	644	25
LRR [sensitive, ls]	645	668	0.015
LRR [sensitive, ls]	645	668	0.29
LRR [sensitive, ls]	669	695	2.4
LRR [sensitive, ls]	669	695	48
LRR [sensitive, ls]	699	723	0.0038
LRR [sensitive, ls]	699	723	0.075
LRR [sensitive, ls]	766	789	0.78
LRR [sensitive, ls]	766	789	15
LRR [sensitive, ls]	790	813	0.46
LRR [sensitive, ls]	790	813	9
LRR [sensitive, ls]	814	837	0.022
LRR [sensitive, ls]	814	837	0.43
LRR [sensitive, ls]	838	861	0.012
LRR [sensitive, ls]	838	861	0.23

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	5	882	2e-69
Cf-9 [L. pimpinellifolium]	9	882	1e-114
CLV2 [A. thaliana]	35	696	5e-40
Xa21 [O. sativa]	40	615	2e-33
CLV2 [A. thaliana]	209	891	1e-48
Xa21 [O. sativa]	306	875	1e-39
FLS2 [A.thaliana]	359	902	8e-41
CLV2 [A. thaliana]	590	873	5e-16
Xa21 [O. sativa]	598	870	1e-17
Xa21 [O. sativa]	764	878	7e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4992.m00086

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)