Report for 4992.m00096

 > 4992.m00096, length: 762, copies: 1 

MCTRQARRRYYETSLLVLMLLLLLQARLAQSLPPCSPDQATALLQLKRSFTVNTASATAFRSWRAGTDCCHWAGV

RCDDDDNDAAASGSTGRRATSLDLGGRGLQSGGLDAAVFSLTSLGYLNLGGNDFNASRLPAVGFERLTELTHLNI

SPPSFTGQIPAGIGRLTNLVSLDLSTLFYVINQEDDRADIMAPSFPNWGFWKVDFLRLVANLDNLRELYLGFVYM

SNGGEGWCNALVNSTPKDQVLSLPFCKISVNDSVVRSPKVAELSLASCNISKFPNAVKHQDELHVIDLSNNQMHG

PIPRWAWETWKELFFLDLSNNKFTSIGHDSLLPCLYTRYINLSYNMFEGPIPIPKENSDLELDYSNNRFSYMPFD

LIPYLAGILSLKASRNNISGEIPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTIKVLNLKANQLNGELPHNI

KEDCAFEALDFSYNRFEGQLPTSLVACKNLVVLDVGNNQIGGSFPCWMHLLPKLQVLVLKSNKFYGQLGPTLTKD

DDCELQHLRILDLASNNFSGILPDEWFRKLKAMMSVSSNEILVMKDGDMYGTYNHITYLFTTTVTYKGLDLTFTK

ILKTFVLIDVSNNRFHGSIPETIATLSVLSGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLD

FLSTLNLSNNMLEGRIPESPHFLTLHNSSFIRNAGLCGPPLSNECSNKSTSSEEKSVDVMLFLFVGLGFGVGFAI

AVVVSWKPCIGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	118	143	8.2
LRR [Pfam ls]	312	335	0.81
LRR [Pfam ls]	406	430	0.35
LRR [Pfam ls]	479	501	3.4
LRR [Pfam ls]	532	556	0.011
LRR [Pfam ls]	652	675	0.035
LRR [Pfam ls]	676	699	0.57

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	117	7.2
LRR [sensitive, ls]	93	117	140
LRR [sensitive, ls]	118	143	0.41
LRR [sensitive, ls]	118	143	8.2
LRR [sensitive, ls]	264	286	2
LRR [sensitive, ls]	264	286	39
LRR [sensitive, ls]	287	311	0.73
LRR [sensitive, ls]	287	311	14
LRR [sensitive, ls]	312	335	0.041
LRR [sensitive, ls]	312	335	0.81
LRR [sensitive, ls]	336	358	4.6
LRR [sensitive, ls]	336	358	90
LRR [sensitive, ls]	382	405	1.2
LRR [sensitive, ls]	382	405	24
LRR [sensitive, ls]	406	430	0.018
LRR [sensitive, ls]	406	430	0.35
LRR [sensitive, ls]	431	451	3.1
LRR [sensitive, ls]	431	451	61
LRR [sensitive, ls]	455	478	3.9
LRR [sensitive, ls]	455	478	78
LRR [sensitive, ls]	479	501	0.17
LRR [sensitive, ls]	479	501	3.4
LRR [sensitive, ls]	503	523	3.4
LRR [sensitive, ls]	503	523	66
LRR [sensitive, ls]	532	556	0.00058
LRR [sensitive, ls]	532	556	0.011
LRR [sensitive, ls]	604	627	0.75
LRR [sensitive, ls]	604	627	15
LRR [sensitive, ls]	628	651	0.54
LRR [sensitive, ls]	628	651	11
LRR [sensitive, ls]	652	675	0.0018
LRR [sensitive, ls]	652	675	0.035
LRR [sensitive, ls]	676	699	0.029
LRR [sensitive, ls]	676	699	0.57

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	14	740	2e-32
Cf-9 [L. pimpinellifolium]	15	726	2e-50
CLV2 [A. thaliana]	28	729	5e-48
FLS2 [A.thaliana]	70	705	5e-38
Xa21 [O. sativa]	92	495	2e-21
Cf-9 [L. pimpinellifolium]	95	754	3e-72
FLS2 [A.thaliana]	104	759	9e-48
Xa21 [O. sativa]	106	548	3e-22
FLS2 [A.thaliana]	260	693	1e-26
FLS2 [A.thaliana]	383	722	4e-22
Xa21 [O. sativa]	383	704	2e-15
FLS2 [A.thaliana]	427	714	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	734	756	out -> in

Report for 4992.m00096

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)