Report for 4992.m00097

 > 4992.m00097, length: 1030, copies: 1 

MNYTHRCLHSHKLPLLILLIAIVVILIQPYSIHAAANSSNTTIRCLTSQSSALLQLKSSFHDASRLSSWQPDTDC

CRWEGVTCRMASGHVVVLDLSDGYLQSNGLHPALFNLTLLTNLALSGNDFMGAQLPDSGFERLSKLVSLDLSATN

FAGQIPIGIGNLSNMLALDLSHNPNLYLTEPSFQTFIANLSNLRELYLDEMDLSSSGATWSSDVAASAPQIQILS

FMSCGLSGFIDPSFSRLRSLTMINVRLNVISGMVPEFFANFSFLTILELSGNAFEGQFPTKIFQLKRLQFIDLYW

NNKLCVQLPEFLPGSRLEVLDLILTNRSNAIPASVVNLKYLKHLGLTTVEASMNSDILLIRELHWLEVLRLYGGS

GQGKLVSFSWIGSLKHLTYLELGNYNFSGLMPSSIINLTNLTSLTLYNCSMSGPIPSWIGNLIQLNNLNFRNNNL

NGTIPKSIFALPALQSLYLDSNQLSGHLEDIPVPLSSSVYDIDLSNNWLHGPIPKSFFCLPNLEYLNLESNHLTG

IVELRPFWRLRSLYFLGFSNNKLSVIDGEDSPSQYLPKIQHLGLACCNLTKLPRILRHLYDILELDLSSNKIGGV

IPGWIWEIWKDTLGSLDLSNNAFTSLENSPSLVTFTHLSHLNLSFNRLQGEIPIPAISLPYGVVVLDYSNNGFSS

ILRTFGRYLNKVAYINLSKNKLKGYVPISICSMKKLQFLYLSDNNFSGFVPSCLVEGRSLRVLNLRGNKFNGMLP

KGIKEGCKLETIDLNSNQIEGRLPRTLSNCKSLELLDVSNNHILDLFPLWLGNLPKLRVLVLRSNQLYGTIKGLH

NSDLTRDHFSSLQILDLANNTLSGQLPPKWFEKLKSMMANVDDGQVLEHQTNFSQGFIYRDIITITYKGFDMTFN

RMLTTFKAIDFSNNSFVGVIPGTIGSLVSLHGLNMSHNNFTGAIPQQLGNLAQLESLDLSWNQLSGVIPHELTFL

TSLSWLNLSNNNLTGRIPQSNQFLSFSNSSFEGQRGNLLYLLEISLNLLCFGFGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	89	113	8.2
LRR [Pfam ls]	140	163	8.7
LRR [Pfam ls]	268	291	6.8
LRR [Pfam ls]	391	414	5.4
LRR [Pfam ls]	415	438	0.52
LRR [Pfam ls]	439	462	2.6
LRR [Pfam ls]	488	511	1.1
LRR [Pfam ls]	512	533	0.12
LRR [Pfam ls]	563	585	3.7
LRR [Pfam ls]	612	634	5.7
LRR [Pfam ls]	637	660	0.67
LRR [Pfam ls]	710	730	1
LRR [Pfam ls]	734	754	8.2
LRR [Pfam ls]	758	781	0.15
LRR [Pfam ls]	782	805	0.13
LRR [Pfam fs]	836	860	5.2e-05
LRR [Pfam ls]	836	860	0.00084
LRR [Pfam ls]	929	952	0.4
LRR [Pfam ls]	953	976	0.057
LRR [Pfam ls]	977	1000	0.72

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	113	0.42
LRR [sensitive, ls]	89	113	8.2
LRR [sensitive, ls]	114	139	0.96
LRR [sensitive, ls]	114	139	19
LRR [sensitive, ls]	140	163	0.44
LRR [sensitive, ls]	140	163	8.7
LRR [sensitive, ls]	164	194	3.7
LRR [sensitive, ls]	164	194	72
LRR [sensitive, ls]	220	243	1.8
LRR [sensitive, ls]	220	243	35
LRR [sensitive, ls]	244	267	0.86
LRR [sensitive, ls]	244	267	17
LRR [sensitive, ls]	268	291	0.35
LRR [sensitive, ls]	268	291	6.8
LRR [sensitive, ls]	292	316	2.6
LRR [sensitive, ls]	292	316	50
LRR [sensitive, ls]	391	414	0.27
LRR [sensitive, ls]	391	414	5.4
LRR [sensitive, ls]	415	438	0.026
LRR [sensitive, ls]	415	438	0.52
LRR [sensitive, ls]	439	462	0.13
LRR [sensitive, ls]	439	462	2.6
LRR [sensitive, ls]	463	486	0.75
LRR [sensitive, ls]	463	486	15
LRR [sensitive, ls]	488	511	0.058
LRR [sensitive, ls]	488	511	1.1
LRR [sensitive, ls]	512	533	0.006
LRR [sensitive, ls]	512	533	0.12
LRR [sensitive, ls]	537	557	2
LRR [sensitive, ls]	537	557	39
LRR [sensitive, ls]	563	585	0.19
LRR [sensitive, ls]	563	585	3.7
LRR [sensitive, ls]	586	609	0.84
LRR [sensitive, ls]	586	609	17
LRR [sensitive, ls]	612	634	0.29
LRR [sensitive, ls]	612	634	5.7
LRR [sensitive, ls]	637	660	0.034
LRR [sensitive, ls]	637	660	0.67
LRR [sensitive, ls]	686	709	1.1
LRR [sensitive, ls]	686	709	21
LRR [sensitive, ls]	710	730	0.051
LRR [sensitive, ls]	710	730	1
LRR [sensitive, ls]	734	754	0.42
LRR [sensitive, ls]	734	754	8.2
LRR [sensitive, ls]	758	781	0.0077
LRR [sensitive, ls]	758	781	0.15
LRR [sensitive, ls]	782	805	0.0067
LRR [sensitive, ls]	782	805	0.13
LRR [sensitive, ls]	806	828	1.9
LRR [sensitive, ls]	806	828	37
LRR [sensitive, ls]	836	860	4.3e-05
LRR [sensitive, ls]	836	860	0.00084
LRR [sensitive, ls]	905	928	0.74
LRR [sensitive, ls]	905	928	15
LRR [sensitive, ls]	929	952	0.02
LRR [sensitive, ls]	929	952	0.4
LRR [sensitive, ls]	953	976	0.0029
LRR [sensitive, ls]	953	976	0.057
LRR [sensitive, ls]	977	1000	0.037
LRR [sensitive, ls]	977	1000	0.72

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	13	769	3e-45
CLV2 [A. thaliana]	51	677	2e-46
FLS2 [A.thaliana]	76	829	9e-66
Xa21 [O. sativa]	140	809	8e-42
FLS2 [A.thaliana]	210	1008	1e-64
Cf-9 [L. pimpinellifolium]	272	1027	3e-86
Xa21 [O. sativa]	316	821	3e-40
CLV2 [A. thaliana]	342	949	2e-41
CLV2 [A. thaliana]	395	994	2e-52
Xa21 [O. sativa]	416	1008	4e-42
CLV2 [A. thaliana]	466	1008	3e-34
CLV2 [A. thaliana]	568	1015	4e-32
Xa21 [O. sativa]	582	1008	1e-34
FLS2 [A.thaliana]	629	1009	1e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out

Report for 4992.m00097

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)