Report for 4992.m00099

 > 4992.m00099, length: 996, copies: 1 

MSPRVAQREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDG

GRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSL

TNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTP

KIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLT

AIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFE

VSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPL

NNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSN

NQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSS

MPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGEL

PHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPT

LAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDM

MFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKL

ASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFV

GLGFGVGFAIAIVVRKPCIGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	127	0.26
LRR [Pfam ls]	250	273	0.19
LRR [Pfam ls]	274	298	6.2
LRR [Pfam ls]	322	345	2.2
LRR [Pfam ls]	394	417	0.055
LRR [Pfam ls]	517	541	4.1
LRR [Pfam ls]	635	659	0.35
LRR [Pfam ls]	660	680	0.97
LRR [Pfam ls]	708	730	5.8
LRR [Pfam ls]	761	785	0.09
LRR [Pfam ls]	881	904	0.035
LRR [Pfam ls]	905	928	0.97

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	77	101	2.7
LRR [sensitive, ls]	77	101	52
LRR [sensitive, ls]	102	127	0.013
LRR [sensitive, ls]	102	127	0.26
LRR [sensitive, ls]	152	183	5
LRR [sensitive, ls]	152	183	99
LRR [sensitive, ls]	226	249	2.6
LRR [sensitive, ls]	226	249	51
LRR [sensitive, ls]	250	273	0.0096
LRR [sensitive, ls]	250	273	0.19
LRR [sensitive, ls]	274	298	0.32
LRR [sensitive, ls]	274	298	6.2
LRR [sensitive, ls]	322	345	0.11
LRR [sensitive, ls]	322	345	2.2
LRR [sensitive, ls]	346	369	0.71
LRR [sensitive, ls]	346	369	14
LRR [sensitive, ls]	370	393	5.7
LRR [sensitive, ls]	370	393	110
LRR [sensitive, ls]	394	417	0.0028
LRR [sensitive, ls]	394	417	0.055
LRR [sensitive, ls]	418	441	1.5
LRR [sensitive, ls]	418	441	29
LRR [sensitive, ls]	442	466	1.9
LRR [sensitive, ls]	442	466	38
LRR [sensitive, ls]	467	493	0.57
LRR [sensitive, ls]	467	493	11
LRR [sensitive, ls]	494	513	0.7
LRR [sensitive, ls]	494	513	14
LRR [sensitive, ls]	517	541	0.21
LRR [sensitive, ls]	517	541	4.1
LRR [sensitive, ls]	542	565	2.7
LRR [sensitive, ls]	542	565	54
LRR [sensitive, ls]	635	659	0.018
LRR [sensitive, ls]	635	659	0.35
LRR [sensitive, ls]	660	680	0.049
LRR [sensitive, ls]	660	680	0.97
LRR [sensitive, ls]	684	707	1.4
LRR [sensitive, ls]	684	707	28
LRR [sensitive, ls]	708	730	0.3
LRR [sensitive, ls]	708	730	5.8
LRR [sensitive, ls]	732	760	5.8
LRR [sensitive, ls]	732	760	110
LRR [sensitive, ls]	761	785	0.0046
LRR [sensitive, ls]	761	785	0.09
LRR [sensitive, ls]	833	856	0.75
LRR [sensitive, ls]	833	856	15
LRR [sensitive, ls]	857	880	0.59
LRR [sensitive, ls]	857	880	12
LRR [sensitive, ls]	881	904	0.0018
LRR [sensitive, ls]	881	904	0.035
LRR [sensitive, ls]	905	928	0.049
LRR [sensitive, ls]	905	928	0.97

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	14	989	7e-97
Xa21 [O. sativa]	14	724	1e-42
CLV2 [A. thaliana]	24	699	1e-45
FLS2 [A.thaliana]	66	890	9e-66
FLS2 [A.thaliana]	216	996	1e-76
Xa21 [O. sativa]	226	777	2e-40
CLV2 [A. thaliana]	319	981	6e-54
Xa21 [O. sativa]	323	953	3e-48

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	32	in -> out
putative TM domain	967	989	out -> in

Report for 4992.m00099

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)