Report for 5013.m00064

 > 5013.m00064, length: 1080, copies: 2 

MVVRRTAVLLLLLHLVFVIAAAAAAVDRRRPAEAIVGGWRQRRRLQALMQEKATLLALKRGLTLLSPKLLADWND

SNTDVCGFTGVACDRRRQHVVGLQLSNMSINGSIPLALAQLPHLRYLDLSDNHISGAVPSFLSNLTQLLMLDMSE

NQLSGAIPPSFGNLTQLRKLDISKNQLSGAIPPSFGNLTNLEILDMSINVLTGRIPEELSNIGKLEGLNLGQNNL

VGSIPASFTQLKNLFYLSLEKNSLSGSIPATIFTNCTQMGVFDLGDNNITGEIPGDASDSLSDRFAVLNLYSNSL

TGRLPRWLANCTILYLLDVENNSLADDLPTSIISGLRNLRYLHLSNNVHFASGDGNTNLGPFFAAVSNCTSILEI

EAGALGIGGRLPSLLGSLLPPNMSHLNLELNAIEGPIPADIGDVINITLMNLSSNLLNGTIPTSICWLPNLQQLD

LSRNSLTGAVPACISNATSLGELDLSSNALSGSIPSSIGSLKLSYLSLHRNQLSGEIPASLGQHLGIVRLDLSSN

RLTGEIPDAVAGIVQMSLNLSRNLLGGRLPRGLSRLQMAEVIDLSWNNLTGAIFPELGACAELQVLDLSHNSLTG

VLPSSLDGLESIERLDVSDNSLTGEIPQTLTKCTTLTYLNLSYNDLAGVVPTAGVFANFTSTSYLGNPRLCGAVL

GRRCGRRHRWYQSRKFLVVMCICAAVLAFVLTILCAVSIRKIRERLAAVREEFRRGRRRGGGGSSPVMKYKFPRI

TYRELVEATEEFSPDRLIGTGSYGRVYRGTLRDGTMVAVKVLQLQSGNSTKSFNRECQVLKRIRHRNLMRIVTAC

SLPDFKALVLPFMANGSLERCLYAGPPAGELSLVQRVNICSDIAEGMAYLHHHSPVKVIHCDLKPSNVLINDDMT

ALVSDFGISRLVMSVGGVANAADVGASTANMLCGSIGYIPPEYGYGSNPTTKGDVYSFGVLVLEMVTRKKPIDDM

FDAGLSLHKWVKNHYHGRADAVVDPALARMVRDQTPEVRRMSDVAIGELLELGILCTQESAAVRPTMMDAADDLD

RLKRYIGGETTATFASSLGFSSSTFEDLDD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	118	141	2.1e-05
LRR [Pfam ls]	118	141	0.00035
LRR [Pfam ls]	142	165	0.021
LRR [Pfam fs]	166	189	4.2e-05
LRR [Pfam ls]	166	189	0.00072
LRR [Pfam ls]	190	213	0.72
LRR [Pfam ls]	214	237	0.081
LRR [Pfam ls]	238	262	0.09
LRR [Pfam ls]	263	287	3.4
LRR [Pfam ls]	289	312	1.7
LRR [Pfam ls]	338	367	5.1
LRR [Pfam ls]	445	468	0.078
LRR [Pfam ls]	492	512	2.1
LRR [Pfam ls]	516	539	0.94
LRR [Pfam fs]	587	610	4.2e-05
LRR [Pfam ls]	587	610	0.00071
LRR [Pfam ls]	611	634	0.07
LRR [Pfam ls]	635	660	1.1
Ser/Thr pkinase [Pfam fs]	762	973	3.9e-49
Ser/Thr pkinase [Pfam ls]	762	1045	6.9e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	117	0.45
LRR [sensitive, ls]	94	117	11
LRR [sensitive, ls]	118	141	1.4e-05
LRR [sensitive, ls]	118	141	0.00035
LRR [sensitive, ls]	142	165	0.00082
LRR [sensitive, ls]	142	165	0.021
LRR [sensitive, ls]	166	189	2.8e-05
LRR [sensitive, ls]	166	189	0.00072
LRR [sensitive, ls]	190	213	0.028
LRR [sensitive, ls]	190	213	0.72
LRR [sensitive, ls]	214	237	0.0032
LRR [sensitive, ls]	214	237	0.081
LRR [sensitive, ls]	238	262	0.0035
LRR [sensitive, ls]	238	262	0.09
LRR [sensitive, ls]	263	287	0.13
LRR [sensitive, ls]	263	287	3.4
LRR [sensitive, ls]	289	312	0.065
LRR [sensitive, ls]	289	312	1.7
LRR [sensitive, ls]	313	337	0.46
LRR [sensitive, ls]	313	337	12
LRR [sensitive, ls]	338	367	0.2
LRR [sensitive, ls]	338	367	5.1
LRR [sensitive, ls]	397	420	2.6
LRR [sensitive, ls]	397	420	67
LRR [sensitive, ls]	421	444	0.36
LRR [sensitive, ls]	421	444	9.1
LRR [sensitive, ls]	445	468	0.0031
LRR [sensitive, ls]	445	468	0.078
LRR [sensitive, ls]	469	489	0.21
LRR [sensitive, ls]	469	489	5.4
LRR [sensitive, ls]	492	512	0.082
LRR [sensitive, ls]	492	512	2.1
LRR [sensitive, ls]	516	539	0.037
LRR [sensitive, ls]	516	539	0.94
LRR [sensitive, ls]	563	586	2.3
LRR [sensitive, ls]	563	586	59
LRR [sensitive, ls]	587	610	2.8e-05
LRR [sensitive, ls]	587	610	0.00071
LRR [sensitive, ls]	611	634	0.0027
LRR [sensitive, ls]	611	634	0.07
LRR [sensitive, ls]	635	660	0.044
LRR [sensitive, ls]	635	660	1.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	46	676	3e-75
CLV2 [A. thaliana]	50	627	6e-57
Xa21 [O. sativa]	51	848	1e-118
Cf-9 [L. pimpinellifolium]	63	680	8e-59
FLS2 [A.thaliana]	92	461	9e-45
FLS2 [A.thaliana]	93	651	5e-78
CLV2 [A. thaliana]	95	436	1e-31
CLV2 [A. thaliana]	95	367	5e-20
FLS2 [A.thaliana]	95	1053	1e-140
CLV2 [A. thaliana]	108	652	9e-50
Cf-9 [L. pimpinellifolium]	142	654	7e-45
Rpg1 [Hordeum vulgare]	725	1052	6e-21
Pto [L. esculentum]	739	1044	6e-35
Rpg1 [Hordeum vulgare]	745	1042	1e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	26	in -> out
putative TM domain	691	713	out -> in

Report for 5013.m00064

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)