Report for 5095.m00078

 > 5095.m00078, length: 966, copies: 1 

MTRPNLVFPVIATTWCLLLLQAGSSSPPPQTAPAPALPPSNPCIARERDALLDLKAGLQDPSNYLASWQGDNCCD

EWEGVVCSKRNGHVATLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSG

LVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGL

RNAIPPPLHMNLTSLEVIDLSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNF

NDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNK

ISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLAIVADHNWVPPFKLMIAGLKSCGLG

PKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQISGVLPAMMNEKMVAEVMDFSNNLLEGQ

LQKVPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLNI

SQAGNTSRADLLGVHQNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMK

ELQYLDLAYNSFSGAIPWSLVNLTAMSHRPADNDSLSYIVYYGWSLSTSNVRVIMLANLGPYNFEESGPDFSHIT

SATNESLLVVTKGQQLEFRSGIIYMVNIDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIES

LDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPLSRNCSESSKLLP

DAVDEDKSLSDGVFLYLGMGIGWVVGLWVVLCTFLFMQRWRIICFLVSDRLYDRIRASFTKQSGRN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	112	136	2.7
LRR [Pfam ls]	214	236	1.3
LRR [Pfam ls]	239	260	6
LRR [Pfam ls]	268	291	4
LRR [Pfam ls]	292	314	0.78
LRR [Pfam ls]	315	338	0.061
LRR [Pfam ls]	365	388	0.81
LRR [Pfam ls]	532	554	1.3
LRR [Pfam ls]	555	578	0.75
LRR [Pfam ls]	617	640	5.6
LRR [Pfam ls]	641	664	1.3
LRR [Pfam ls]	676	699	0.28
LRR [Pfam ls]	774	797	1.8
LRR [Pfam ls]	798	821	1.5
LRR [Pfam ls]	822	842	1.8
LRR [Pfam ls]	846	868	0.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	88	111	5.3
LRR [sensitive, ls]	88	111	110
LRR [sensitive, ls]	112	136	0.13
LRR [sensitive, ls]	112	136	2.7
LRR [sensitive, ls]	137	160	0.45
LRR [sensitive, ls]	137	160	9.3
LRR [sensitive, ls]	188	210	3.4
LRR [sensitive, ls]	188	210	70
LRR [sensitive, ls]	214	236	0.064
LRR [sensitive, ls]	214	236	1.3
LRR [sensitive, ls]	239	260	0.29
LRR [sensitive, ls]	239	260	6
LRR [sensitive, ls]	268	291	0.2
LRR [sensitive, ls]	268	291	4
LRR [sensitive, ls]	292	314	0.038
LRR [sensitive, ls]	292	314	0.78
LRR [sensitive, ls]	315	338	0.003
LRR [sensitive, ls]	315	338	0.061
LRR [sensitive, ls]	341	364	0.49
LRR [sensitive, ls]	341	364	10
LRR [sensitive, ls]	365	388	0.039
LRR [sensitive, ls]	365	388	0.81
LRR [sensitive, ls]	389	411	0.48
LRR [sensitive, ls]	389	411	9.9
LRR [sensitive, ls]	414	434	2.7
LRR [sensitive, ls]	414	434	57
LRR [sensitive, ls]	462	486	2.7
LRR [sensitive, ls]	462	486	55
LRR [sensitive, ls]	487	511	2.3
LRR [sensitive, ls]	487	511	47
LRR [sensitive, ls]	532	554	0.061
LRR [sensitive, ls]	532	554	1.3
LRR [sensitive, ls]	555	578	0.036
LRR [sensitive, ls]	555	578	0.75
LRR [sensitive, ls]	579	599	2.8
LRR [sensitive, ls]	579	599	57
LRR [sensitive, ls]	617	640	0.27
LRR [sensitive, ls]	617	640	5.6
LRR [sensitive, ls]	641	664	0.062
LRR [sensitive, ls]	641	664	1.3
LRR [sensitive, ls]	676	699	0.014
LRR [sensitive, ls]	676	699	0.28
LRR [sensitive, ls]	774	797	0.089
LRR [sensitive, ls]	774	797	1.8
LRR [sensitive, ls]	798	821	0.072
LRR [sensitive, ls]	798	821	1.5
LRR [sensitive, ls]	822	842	0.088
LRR [sensitive, ls]	822	842	1.8
LRR [sensitive, ls]	846	868	0.024
LRR [sensitive, ls]	846	868	0.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	24	691	3e-44
FLS2 [A.thaliana]	47	885	8e-65
Xa21 [O. sativa]	50	633	3e-42
Cf-9 [L. pimpinellifolium]	67	930	5e-72
CLV2 [A. thaliana]	178	896	8e-52
Xa21 [O. sativa]	319	885	5e-42

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	914	936	out -> in

Report for 5095.m00078

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)