Report for 5104.m00176

 > 5104.m00176, length: 1066, copies: 1 

MQLPNLPCSSSSSTTTTTTTKLSVAFFRLLVILLLSFASPTSSCTEQEESSLIGFLEGLLPGHNGSLSTSWVKGI

DCCKWEGINCSSDGTVTDVSLASKGLQGRISPSLGNLTGLLHLNLSHNLLNGYLPMELLFSRSIIVLDVSFNRLD

GSLPELESPSGGSPLQVLNISSNSFTGQFSSKQWEVMKNIVALNVSNNSFTGQIPPSICINSPSFAILDLCYNQF

SGSISSGLGNCSKMREFKAGYNNFSGALPEELFSATSLEHLSLPNNDLQGVLDGSHIVKLVKLTVLDLGSTGLSG

NIPDSIGQLSTLEELRLDNNNMSGELPSALGNCTNLRYLSLRNNKFVGDLSKVNFTWLNLRIADFSINNFTGTVP

ESIFSCSNLIALRLAFNKFHGQLSPRMGTLKSLSFFSISDNHFTNITNALQILRSCKNLTSLLIGTNFKGETIPQ

DETVDGFENLRVLTIDSCGAMGQIPPWISKLKKLEVLDLSNNMLIGEIPFWIRDMPVLFYLDITNNSLTGDIPVA

LMNLPMLQSGKNAAQLDPNFLELPVYWTPSRQYRLLNAFPNALNLGNNSFTGVIPPEIGQLKMLDGFNVSFNRLS

GEIPQQICNLTNLQLLDLSSNQLTGELPAALTNLHFLSKFNVSNNELEGPVPTGRQFDTFLNSSYSGNPKLCGPM

LSNLCDSVPTHASSMKQRNKKAIIALALGVFFGGIAILFLLGRFLISIRRTSSVHQNKSSNNGDIEAASLSSVSE

HLHDMIKGTILVMVPQGKGGSNNLKFKDILKATNNFDQQNIIGCGGNGLVYKAELPNGSKLAIKKLNGEMCLMER

EFTAEVEALSMAQHDNLVPLWGYCIQGNSRLLIYSYMENGSLDDWLHNRDNGRPLLDWPTRLKIAQGASRGLSYI

HNICKPHIVHRDIKSSNILLDREFRACVADFGLARLILPYDTHVTTELIGTLGYIPPEYSQAWVATLRGDIYSFG

VVLLELLTGKRPVQVLSKSKELVQWTREMRSHGKDTEVLDPALRGRGHEEQMLKVLDVACKCISHNPCKRPTIQE

VVSCLDNVDADLQVQM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	189	213	0.51
LRR [Pfam ls]	287	310	0.36
LRR [Pfam ls]	311	334	0.03
LRR [Pfam ls]	335	356	4.7
LRR [Pfam ls]	459	482	5.7
LRR [Pfam ls]	483	506	0.021
LRR [Pfam ls]	507	530	0.48
LRR [Pfam ls]	612	635	0.0014
Ser/Thr pkinase [Pfam fs]	786	1055	2.2e-48
Ser/Thr pkinase [Pfam ls]	786	1052	1.3e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	114	137	1.9
LRR [sensitive, ls]	114	137	43
LRR [sensitive, ls]	138	160	0.33
LRR [sensitive, ls]	138	160	7.6
LRR [sensitive, ls]	164	188	0.84
LRR [sensitive, ls]	164	188	20
LRR [sensitive, ls]	189	213	0.022
LRR [sensitive, ls]	189	213	0.51
LRR [sensitive, ls]	214	237	0.47
LRR [sensitive, ls]	214	237	11
LRR [sensitive, ls]	238	261	4.8
LRR [sensitive, ls]	238	261	110
LRR [sensitive, ls]	262	286	0.32
LRR [sensitive, ls]	262	286	7.6
LRR [sensitive, ls]	287	310	0.016
LRR [sensitive, ls]	287	310	0.36
LRR [sensitive, ls]	311	334	0.0013
LRR [sensitive, ls]	311	334	0.03
LRR [sensitive, ls]	335	356	0.2
LRR [sensitive, ls]	335	356	4.7
LRR [sensitive, ls]	359	383	0.63
LRR [sensitive, ls]	359	383	15
LRR [sensitive, ls]	407	429	0.84
LRR [sensitive, ls]	407	429	19
LRR [sensitive, ls]	459	482	0.25
LRR [sensitive, ls]	459	482	5.7
LRR [sensitive, ls]	483	506	0.00091
LRR [sensitive, ls]	483	506	0.021
LRR [sensitive, ls]	507	530	0.021
LRR [sensitive, ls]	507	530	0.48
LRR [sensitive, ls]	564	587	0.53
LRR [sensitive, ls]	564	587	12
LRR [sensitive, ls]	588	611	1.1
LRR [sensitive, ls]	588	611	25
LRR [sensitive, ls]	612	635	6.1e-05
LRR [sensitive, ls]	612	635	0.0014

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	22	667	3e-66
Xa21 [O. sativa]	22	876	9e-70
CLV2 [A. thaliana]	47	734	2e-50
Cf-9 [L. pimpinellifolium]	70	687	2e-59
FLS2 [A.thaliana]	84	1055	3e-98
CLV2 [A. thaliana]	139	664	1e-40
Pto [L. esculentum]	771	1052	3e-47
Rpg1 [Hordeum vulgare]	776	1058	1e-36
Rpg1 [Hordeum vulgare]	783	1059	4e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	699	721	out -> in
putative TM domain	699	721	out -> in

Report for 5104.m00176

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)