Report for 5104.m00181

 > 5104.m00181, length: 1076, copies: 1 

METSGRVVVVVSGVLVLLLAISICGRAAACAEAERAALLSFLAEASPPAGDAIVADWRGSPDCCRWDGVGCGGAG

DGDGAVTRLSLPGRGFNGTISPSIGNLTGLTHLNLSGNSLAGQFPEVLFSLPNVTVVDVSYNCLSGELPSVATGA

AARGGLSLEVLDVSSNLLAGQFPSAIWEHTPRLVSLNASNNSFHGSIPSLCVSCPALAVLDLSVNVLSGVISPGF

GNCSQLRVLSAGRNNLTGELPGELFDVKPLQHLQLPANQIEGRLDQDSLAKLTNLVTLDLSYNLFTGELPESISK

MPKLEELRLANNNLTGTLPSALSNWTSLRFIDLRSNSFVGNLTDVDFSGLPNLTVFDVASNNFTGTMPPSIYSCT

AMKALRVSRNVMGGQVSPEIGNLKQLEFFSLTINSFVNISGMFWNLKGCTSLTALLVSYNFYGEALPDAGWVGDH

VRSVRVIVMQNCALTGVIPSWLSKLQDLNILNLSGNRLTGPIPSWLGAMPKLYYVDLSGNQLSGVIPPSLMEMRL

LTSEQAMAEFNPGHLILMFSLNPDNGAANRQGRGYYQLSGVAATLNFGENGITGTISPEVGKLKTLQVFDVSYNN

LSGGIPPELTGLDRLQVLDLRWNRLTGTIPSALNKLNFLAVFNVAHNDLEGPIPTGGQFDAFPPKNFMGNPKLCG

RAISVPCGNMIGATRDDDPDKHVGKRVLIAIVLGVCIGLVALVVFLGCVVITVRKVMSNGAVRDGGKGVEVSLFD

SMSELYGDCSKDTILFMSEAAGEAAKRLTFVDILKATNNFSQERIIGSGGYGLVFLAELEDGARLAVKKLNGDMC

LVEREFQAEVEALSATRHENLVPLLGFCIRGRLRLLLYPYMANGSLHDWLHERRAGGAGAAPQLLDWRARLNVAR

GASRGVLYIHEQCKPQIVHRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTPGYIPPEYGQAWVAT

RRGDVYSFGVVLLELLTGRRPVEAASPPHGQQRELVRWVLQMRLQGRQAEVLDTRLSGGNEAQMLYVLDLACLCV

DSTPFSRPAIQEVVSWLDNVDTIGRS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	127	0.068
LRR [Pfam ls]	157	181	2.4
LRR [Pfam ls]	182	205	6.2
LRR [Pfam ls]	206	229	5.2
LRR [Pfam ls]	230	253	5
LRR [Pfam ls]	279	302	0.0057
LRR [Pfam ls]	303	326	0.0016
LRR [Pfam ls]	327	351	1.3
LRR [Pfam ls]	352	375	5.5
LRR [Pfam ls]	453	476	1.9
LRR [Pfam ls]	477	500	0.025
LRR [Pfam ls]	501	524	0.18
LRR [Pfam ls]	590	613	0.095
LRR [Pfam ls]	614	637	0.012
Ser/Thr pkinase [Pfam fs]	790	996	6.2e-53
Ser/Thr pkinase [Pfam ls]	790	1067	4.7e-53

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	103	4.4
LRR [sensitive, ls]	80	103	100
LRR [sensitive, ls]	104	127	0.0029
LRR [sensitive, ls]	104	127	0.068
LRR [sensitive, ls]	128	148	0.52
LRR [sensitive, ls]	128	148	12
LRR [sensitive, ls]	157	181	0.1
LRR [sensitive, ls]	157	181	2.4
LRR [sensitive, ls]	182	205	0.27
LRR [sensitive, ls]	182	205	6.2
LRR [sensitive, ls]	206	229	0.22
LRR [sensitive, ls]	206	229	5.2
LRR [sensitive, ls]	230	253	0.21
LRR [sensitive, ls]	230	253	5
LRR [sensitive, ls]	254	278	0.37
LRR [sensitive, ls]	254	278	8.5
LRR [sensitive, ls]	279	302	0.00024
LRR [sensitive, ls]	279	302	0.0057
LRR [sensitive, ls]	303	326	7.1e-05
LRR [sensitive, ls]	303	326	0.0016
LRR [sensitive, ls]	327	351	0.057
LRR [sensitive, ls]	327	351	1.3
LRR [sensitive, ls]	352	375	0.24
LRR [sensitive, ls]	352	375	5.5
LRR [sensitive, ls]	376	399	4.8
LRR [sensitive, ls]	376	399	110
LRR [sensitive, ls]	400	422	1.4
LRR [sensitive, ls]	400	422	33
LRR [sensitive, ls]	453	476	0.08
LRR [sensitive, ls]	453	476	1.9
LRR [sensitive, ls]	477	500	0.0011
LRR [sensitive, ls]	477	500	0.025
LRR [sensitive, ls]	501	524	0.0077
LRR [sensitive, ls]	501	524	0.18
LRR [sensitive, ls]	566	589	2.4
LRR [sensitive, ls]	566	589	55
LRR [sensitive, ls]	590	613	0.0041
LRR [sensitive, ls]	590	613	0.095
LRR [sensitive, ls]	614	637	0.00053
LRR [sensitive, ls]	614	637	0.012
LRR [sensitive, ls]	638	671	3.8
LRR [sensitive, ls]	638	671	89

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	15	654	1e-57
Xa21 [O. sativa]	31	876	2e-70
CLV2 [A. thaliana]	54	674	6e-51
Cf-9 [L. pimpinellifolium]	57	719	2e-53
FLS2 [A.thaliana]	75	421	9e-35
FLS2 [A.thaliana]	84	375	3e-28
FLS2 [A.thaliana]	94	1067	5e-93
FLS2 [A.thaliana]	201	656	4e-35
Pto [L. esculentum]	777	1064	4e-39
Rpg1 [Hordeum vulgare]	787	1076	2e-31
Rpg1 [Hordeum vulgare]	787	1073	2e-28

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	706	728	out -> in
putative TM domain	706	728	out -> in

Report for 5104.m00181

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)