Report for 5104.m00183

 > 5104.m00183, length: 1056, copies: 1 

MGCHQVVVTGVLVLVLAASVSDRAAACVEAEREALLSFLAEAAPPAGDGIVGEWQRSPDCCTWDGVGCGDDGEIT

RLSLPGRGLGGTISPSIGNLTALVYLNLSGNDLSGPFPDVLFFLPNVTIVDVSYNCISDELPDMLPPAAADIVQG

GLSLQVLDVSSNLLAGQFPSAIWEHTPRLVSLNASNNSFRGTIPSLCVSCPALAVLDLSVNMLTGAISPGFGNCS

QLRVLSAGRNNLTGELPGDIFDVKSLQHLHLPSNQIEGRLDHPECIAKLTNLVTLDLSYNLLAGELPESISQITK

LEEVRLIHNNLTGKLPPALSNWTSLRCIDLRSNRFTGDLTGIDFSGLDNLTIFDVDSNNFTGTIPPSIYSCTAMK

ALRVSHNLIGGQVAPEISNLKELQFLSLTINSFVNISGMFWNLKGCTSLTALLVSYNFYGEALPDAGWVGDHIKS

VRVIVMENCALTGTIPSWLSKLQDLNILNLSGNRLTGPIPSWLGGMSKLYYLDLSGNLLSGEIPPSLKEIRLLTS

EQAMAEFNPGHLPLMFSVKPDRRAADRQGRGYYQLSGVAATLNLSDNGITGTISPEVGKLKTLQVLDVSYNNLSG

GIPPELSNLTKLQILDLRWNHLTGTIPPSLNELNFLAIFNVAYNDLEGPIPTGGQFDAFPPRSFKGNPKLCGLVI

SVPCSNKFEARYHTSSKVVGKKVLIAIVLGVSFGLVILIVSLGCLVIAVRRVMSNGAVHDGGRGVGASLFDSMSS

ELYNDNDSSKDTIFFMSEVAGEAAKAVTFVDVLKATNNFSPANIIGSGGYGLVFLAEMEDGARLAVKKLNGDMCL

VEREFQAEVEALSATRHENLVPLLGFCIRGRLRLLIYPYMANGSLEDWLHERHAARGVLHIHERCKPHIVHRDIK

SSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTPGYIPPEYGQAWVATLRGDIYSFGVVLLELLTGRRPVE

TLPPPQGQQWELVRWVMQMRSQGRHAEVLDPRLRGNGDEAQMLNMLDLACLCVDSTPFSRPEIQDVVRWLDNVDT

IGRADV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	0.08
LRR [Pfam ls]	153	177	2.1
LRR [Pfam ls]	178	201	3.1
LRR [Pfam ls]	202	225	2.1
LRR [Pfam ls]	226	249	4.9
LRR [Pfam ls]	276	299	0.19
LRR [Pfam ls]	300	323	0.15
LRR [Pfam ls]	349	372	1.7
LRR [Pfam ls]	450	473	3.9
LRR [Pfam ls]	474	497	0.017
LRR [Pfam ls]	498	518	0.023
LRR [Pfam ls]	563	586	6.6
LRR [Pfam fs]	587	610	1.5e-05
LRR [Pfam ls]	587	610	0.00023
LRR [Pfam ls]	611	634	0.023
Ser/Thr pkinase [Pfam fs]	789	877	1.7e-13
Ser/Thr pkinase [Pfam ls]	789	1045	6.6e-41
Ser/Thr pkinase [Pfam fs]	880	995	6.8e-27

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	73	96	1.3
LRR [sensitive, ls]	73	96	31
LRR [sensitive, ls]	97	120	0.0035
LRR [sensitive, ls]	97	120	0.08
LRR [sensitive, ls]	121	141	0.86
LRR [sensitive, ls]	121	141	20
LRR [sensitive, ls]	153	177	0.091
LRR [sensitive, ls]	153	177	2.1
LRR [sensitive, ls]	178	201	0.13
LRR [sensitive, ls]	178	201	3.1
LRR [sensitive, ls]	202	225	0.089
LRR [sensitive, ls]	202	225	2.1
LRR [sensitive, ls]	226	249	0.21
LRR [sensitive, ls]	226	249	4.9
LRR [sensitive, ls]	250	275	0.38
LRR [sensitive, ls]	250	275	8.9
LRR [sensitive, ls]	276	299	0.0081
LRR [sensitive, ls]	276	299	0.19
LRR [sensitive, ls]	300	323	0.0063
LRR [sensitive, ls]	300	323	0.15
LRR [sensitive, ls]	324	348	0.57
LRR [sensitive, ls]	324	348	13
LRR [sensitive, ls]	349	372	0.073
LRR [sensitive, ls]	349	372	1.7
LRR [sensitive, ls]	373	396	0.64
LRR [sensitive, ls]	373	396	15
LRR [sensitive, ls]	397	419	0.46
LRR [sensitive, ls]	397	419	11
LRR [sensitive, ls]	450	473	0.17
LRR [sensitive, ls]	450	473	3.9
LRR [sensitive, ls]	474	497	0.00074
LRR [sensitive, ls]	474	497	0.017
LRR [sensitive, ls]	498	518	0.00099
LRR [sensitive, ls]	498	518	0.023
LRR [sensitive, ls]	563	586	0.28
LRR [sensitive, ls]	563	586	6.6
LRR [sensitive, ls]	587	610	9.8e-06
LRR [sensitive, ls]	587	610	0.00023
LRR [sensitive, ls]	611	634	0.001
LRR [sensitive, ls]	611	634	0.023
LRR [sensitive, ls]	635	668	2.8
LRR [sensitive, ls]	635	668	64

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	13	889	6e-72
FLS2 [A.thaliana]	29	651	3e-63
Cf-9 [L. pimpinellifolium]	54	715	1e-56
CLV2 [A. thaliana]	60	700	2e-43
FLS2 [A.thaliana]	74	418	5e-30
FLS2 [A.thaliana]	84	1045	9e-96
CLV2 [A. thaliana]	116	652	2e-41
Pto [L. esculentum]	781	1042	2e-35
Rpg1 [Hordeum vulgare]	786	1056	9e-28
Rpg1 [Hordeum vulgare]	786	1051	9e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	702	724	out -> in
putative TM domain	702	724	out -> in

Report for 5104.m00183

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)