Report for 5104.m00185

 > 5104.m00185, length: 1070, copies: 1 

MPRRELEMSCHVVVSGVLVLVLAATICGCAAACVEVERKALLSFLADAASRAGDGIVGEWQRSPDCCTWDGVGCG

GDGEVTRLSLPGRGLGGTISPSIGNLTGLTHLNLSGNSLAGQFPEVLFSLPNVTVVDVSYNCLSGELPSVATGAA

ARGGLSLEVLDVSSNLLAGQFPSAIWEHTPRLVSLNASNNSFHGTIPSLCVSCPALAVLDLSVNVLSGVISPGFG

NCSQLRVFSAGRNNLTGELPGDLFDVKALQHLELPLNQIEGQLDHESIAKLTNLVTLDLGYNLLTGGLPESISKM

PKLEELRLANNNLTGTLPSALSNWTSLRFIDLRSNSFVGDLTVVDFSGLANLTVFDVASNNFTGTIPPSIYTCTA

MKALRVSRNVMGGQVSPEIGNLKELELFSLTFNSFVNISGMFWNLKSCTNLTALLLSYNFYGEALPDAGWVGDHI

RKVRVIVLEKSALTGAIPSWLSKLQDLNILNLSGNRLTGPIPSWLGAMPKLYYVDLSGNLLSGVIPPSLMEMRLL

TSEQAMAEYNPGHLILTFALNPDNGEANRHGRGYYQLSGVAVTLNFSENAITGTISPEVGKLKTLQMLDVSYNNL

SGDIPTELTSLARLQVLDLSWNLLTGTIPSALNKLNFLAVFNVAHNDLEGPIPTGGQFDAFPPKSFMGNAKLCGR

AISVPCGNMNGATRGNDPIKHVGKRVIIAIVLGVCFGLVALVIFLGCVVITVRKLMSNAAVRDGGKGVDVSLFDS

MSELYGDCSKDTILFMSEAAGETAKSLTFLDILKATNNFSPERIIGSGGYGLVFLAELEDGTRLAVKKLNGDMCL

VEREFQAEVEALSATRHENLVPLLGFYIRGQLRLLIYPYMANGSLHDWLHESHAGDGAPQQLDWRARLSIARGAS

RGVLYIHDQCKPQIVHRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTLGYIPPEYGQAWVATRRG

DVYSFGVVLLELLTGRRPFEVLRHGQQLELVQWVLQMRSQGRHGEVLDQRLRGNGDEAQMLYVLDLACLCVDSTP

LSRPVIQDIVSWLDNVQFIG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.068
LRR [Pfam ls]	156	180	2.4
LRR [Pfam ls]	181	204	5.9
LRR [Pfam ls]	205	228	5.2
LRR [Pfam ls]	278	301	0.013
LRR [Pfam ls]	302	325	0.0016
LRR [Pfam ls]	326	350	5.9
LRR [Pfam ls]	351	374	2
LRR [Pfam ls]	476	499	0.025
LRR [Pfam ls]	500	523	0.37
LRR [Pfam ls]	589	612	0.23
LRR [Pfam ls]	613	636	0.006
Ser/Thr pkinase [Pfam fs]	789	995	7.9e-53
Ser/Thr pkinase [Pfam ls]	789	1063	3.5e-51

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	1.7
LRR [sensitive, ls]	79	102	40
LRR [sensitive, ls]	103	126	0.0029
LRR [sensitive, ls]	103	126	0.068
LRR [sensitive, ls]	127	147	0.52
LRR [sensitive, ls]	127	147	12
LRR [sensitive, ls]	156	180	0.1
LRR [sensitive, ls]	156	180	2.4
LRR [sensitive, ls]	181	204	0.25
LRR [sensitive, ls]	181	204	5.9
LRR [sensitive, ls]	205	228	0.22
LRR [sensitive, ls]	205	228	5.2
LRR [sensitive, ls]	229	252	0.62
LRR [sensitive, ls]	229	252	14
LRR [sensitive, ls]	253	277	0.38
LRR [sensitive, ls]	253	277	8.7
LRR [sensitive, ls]	278	301	0.00055
LRR [sensitive, ls]	278	301	0.013
LRR [sensitive, ls]	302	325	7.1e-05
LRR [sensitive, ls]	302	325	0.0016
LRR [sensitive, ls]	326	350	0.26
LRR [sensitive, ls]	326	350	5.9
LRR [sensitive, ls]	351	374	0.087
LRR [sensitive, ls]	351	374	2
LRR [sensitive, ls]	375	398	4.8
LRR [sensitive, ls]	375	398	110
LRR [sensitive, ls]	399	421	0.64
LRR [sensitive, ls]	399	421	15
LRR [sensitive, ls]	452	475	0.94
LRR [sensitive, ls]	452	475	22
LRR [sensitive, ls]	476	499	0.0011
LRR [sensitive, ls]	476	499	0.025
LRR [sensitive, ls]	500	523	0.016
LRR [sensitive, ls]	500	523	0.37
LRR [sensitive, ls]	565	588	0.77
LRR [sensitive, ls]	565	588	18
LRR [sensitive, ls]	589	612	0.01
LRR [sensitive, ls]	589	612	0.23
LRR [sensitive, ls]	613	636	0.00026
LRR [sensitive, ls]	613	636	0.006
LRR [sensitive, ls]	637	670	4.2
LRR [sensitive, ls]	637	670	98

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	18	653	3e-62
Xa21 [O. sativa]	40	894	2e-71
Cf-9 [L. pimpinellifolium]	60	688	4e-57
CLV2 [A. thaliana]	66	685	8e-52
FLS2 [A.thaliana]	76	422	2e-32
FLS2 [A.thaliana]	83	360	5e-25
FLS2 [A.thaliana]	90	1063	8e-97
FLS2 [A.thaliana]	200	655	3e-37
Pto [L. esculentum]	781	1060	3e-40
Rpg1 [Hordeum vulgare]	786	1069	3e-30
Rpg1 [Hordeum vulgare]	786	1069	9e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	12	34	in -> out
putative TM domain	12	34	in -> out
putative TM domain	703	725	out -> in
putative TM domain	703	725	out -> in

Report for 5104.m00185

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)