Report for 5134.m00133

 > 5134.m00133, length: 971, copies: 1 

MRALVVLVGLACLAFVAEAKGGGAASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGR

VAGLSLAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGHWRNLR

DVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLN

LRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSG

NKFSGEIPGSIGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLPSWVFASGVQWVSVSDNTLS

GEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSI

PATVGGESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQTVDLSRNKLTGGLPKQL

SDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPGLCGAKLNSSCPGVLPKPIVLNPDSSSDPLSQPEPTP

NGLRHKKTILSISALVAIGAAVLITVGVITITVLNLRVRTPGSHSAAELELSDGYLSQSPTTDVNSGKLVMFGGG

NPEFSASTHALLNKDCELGRGGFGTVYKTTLRDGQPVAIKKLTVSSLVKSQDEFEREVKMLGKLRHRNLVALKGY

YWTPSLQLLIYEFVSGGNLHKQLHESSTANCLSWKERFDIVLGIARSLAHLHRHDIIHYNLKSSNILLDGSGDAK

VGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVLCD

VVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCPQDSPETELG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	0.0023
LRR [Pfam ls]	123	147	0.088
LRR [Pfam ls]	172	195	1.7
LRR [Pfam ls]	196	219	0.37
LRR [Pfam ls]	220	243	0.038
LRR [Pfam ls]	244	267	1.8
LRR [Pfam ls]	292	315	0.01
LRR [Pfam ls]	316	339	0.015
LRR [Pfam ls]	411	434	0.37
LRR [Pfam ls]	458	481	0.067
LRR [Pfam ls]	482	505	0.18
LRR [Pfam ls]	506	529	0.0049
LRR [Pfam ls]	530	554	0.64
Ser/Thr pkinase [Pfam fs]	687	887	6.7e-49
Ser/Thr pkinase [Pfam ls]	687	958	2.5e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	99	122	7.3e-05
LRR [sensitive, ls]	99	122	0.0023
LRR [sensitive, ls]	123	147	0.0028
LRR [sensitive, ls]	123	147	0.088
LRR [sensitive, ls]	148	171	0.55
LRR [sensitive, ls]	148	171	17
LRR [sensitive, ls]	172	195	0.055
LRR [sensitive, ls]	172	195	1.7
LRR [sensitive, ls]	196	219	0.012
LRR [sensitive, ls]	196	219	0.37
LRR [sensitive, ls]	220	243	0.0012
LRR [sensitive, ls]	220	243	0.038
LRR [sensitive, ls]	244	267	0.059
LRR [sensitive, ls]	244	267	1.8
LRR [sensitive, ls]	268	291	0.42
LRR [sensitive, ls]	268	291	13
LRR [sensitive, ls]	292	315	0.00034
LRR [sensitive, ls]	292	315	0.01
LRR [sensitive, ls]	316	339	0.00047
LRR [sensitive, ls]	316	339	0.015
LRR [sensitive, ls]	340	364	0.3
LRR [sensitive, ls]	340	364	9.4
LRR [sensitive, ls]	411	434	0.012
LRR [sensitive, ls]	411	434	0.37
LRR [sensitive, ls]	435	455	0.55
LRR [sensitive, ls]	435	455	17
LRR [sensitive, ls]	458	481	0.0022
LRR [sensitive, ls]	458	481	0.067
LRR [sensitive, ls]	482	505	0.0058
LRR [sensitive, ls]	482	505	0.18
LRR [sensitive, ls]	506	529	0.00016
LRR [sensitive, ls]	506	529	0.0049
LRR [sensitive, ls]	530	554	0.02
LRR [sensitive, ls]	530	554	0.64

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	774	2e-78
FLS2 [A.thaliana]	22	546	4e-67
CLV2 [A. thaliana]	33	592	6e-67
Cf-9 [L. pimpinellifolium]	50	545	3e-48
Cf-9 [L. pimpinellifolium]	79	498	3e-49
FLS2 [A.thaliana]	79	960	1e-104
Cf-9 [L. pimpinellifolium]	86	576	9e-60
FLS2 [A.thaliana]	122	548	8e-54
Cf-9 [L. pimpinellifolium]	270	562	2e-15
FLS2 [A.thaliana]	272	550	2e-28
Pto [L. esculentum]	693	965	9e-37
Rpg1 [Hordeum vulgare]	693	966	5e-23
Rpg1 [Hordeum vulgare]	695	959	2e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	614	636	out -> in

Report for 5134.m00133

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)