Report for 5182.m00148

 > 5182.m00148, length: 1128, copies: 2 

MSKLALLLRGAAMILWLLISQTPSTCCVHARCVTGERDALLSFKASLLDPSGRLSSWQGDDCCQWKGVRCSNRTG

NIVALNLRNTNNFWYDFYDADGLNLLRGGDLSLLGGELSSSLIALHHLRHLDLSCNFFNGTSIPVFMGSFKNLRY

LNLSWAGFGGKIPSQIGNISSLQYLDVSSNYFFHEQNTFFMSSTDLSWLPRLTFLRHVDMTDVDLSSVRDWVHMV

NMLPALQVLRLSECGLNHTVSKLSHSNLTNLEVLDLSFNQFSYTPLRHNWFWDLTSLEELYLSEYAWFAPAEPIP

DRLGNMSALRVLDLSYSSIVGLFPKTLENMCNLQVLLMDGNNIDADLREFMERLPMCSLNSLEELNLEYTNMSGT

FPTFIHKMSNLSVLLLFGNKLVGELPAGVGALGNLKILALSNNNFRGLVPLETVSSLDTLYLNNNKFNGFVPLEV

GAVSNLKKLFLAYNTFSGPAPSWIGTLGNLTILDLSYNNLSGPVPLEIGAVNLKILYLNNNKFSGFVPLGIGAVS

HLKVLYLSYNNFSGPAPSWVGALGNLQILDLSHNSFSGPVPPGIGSLSNLTTLDLSYNRFQGVISKDHVEHLSRL

KYLDLSDNFLKIDIHTNSSPPFKLRNAAFRSCQLGPRFPLWLRWQTDIDVLVLENTKLDDVIPDWFWVTFSRASF

LQASGNKLHGSLPPSLEHISVGRIYLGSNLLTGQVPQLPISMTRLNLSSNFLSGPLPSLKAPLLEELLLANNNIT

GSIPPSMCQLTGLKRLDLSGNKITGDLEQMQCWKQSDMTNTNSADKFGSSMLSLALNHNELSGIFPQFLQNASQL

LFLDLSHNRFFGSLPKWLPERMPNLQILRLRSNIFHGHIPKNIIYLGKLHFLDIAHNNISGSIPDSLANFKAMTV

IAQNSEDYIFEESIPVITKDQQRDYTFEIYNQVVNLDFSCNKLTGHIPEEIHLLIGLTNLNLSSNQFSGTIHDQI

GDLKQLESLDLSYNELSGEIPPSLSALTSLSHLNLSYNNLSGTIPSGSQLQALDDQIYIYVGNPGLCGPPLLKNC

STNGTQQSFYEDRSHMRSLYLGMSIGFVIGLWTVFCTMMMKRTWMMAYFRIIDNLYDKAYVQVAISWSRLMRKNQ

DAA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	122	145	2
LRR [Pfam ls]	147	170	8.7
LRR [Pfam ls]	255	280	0.22
LRR [Pfam ls]	308	331	1.9
LRR [Pfam ls]	361	384	9.6
LRR [Pfam ls]	409	430	2.4
LRR [Pfam ls]	455	478	2.7
LRR [Pfam ls]	479	501	7
LRR [Pfam ls]	502	525	3.5
LRR [Pfam ls]	526	549	0.06
LRR [Pfam ls]	550	573	0.03
LRR [Pfam ls]	574	598	0.019
LRR [Pfam ls]	599	623	3.9
LRR [Pfam ls]	738	761	0.22
LRR [Pfam ls]	762	784	0.51
LRR [Pfam ls]	824	848	2.6
LRR [Pfam ls]	873	896	0.013
LRR [Pfam ls]	932	955	4.2
LRR [Pfam ls]	956	979	0.57
LRR [Pfam fs]	980	1003	3.6e-05
LRR [Pfam ls]	980	1003	0.00058
LRR [Pfam ls]	1004	1026	0.038

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	122	145	0.1
LRR [sensitive, ls]	122	145	2
LRR [sensitive, ls]	147	170	0.44
LRR [sensitive, ls]	147	170	8.7
LRR [sensitive, ls]	171	203	4.2
LRR [sensitive, ls]	171	203	83
LRR [sensitive, ls]	230	252	1.2
LRR [sensitive, ls]	230	252	24
LRR [sensitive, ls]	255	280	0.011
LRR [sensitive, ls]	255	280	0.22
LRR [sensitive, ls]	308	331	0.097
LRR [sensitive, ls]	308	331	1.9
LRR [sensitive, ls]	332	355	1
LRR [sensitive, ls]	332	355	21
LRR [sensitive, ls]	361	384	0.49
LRR [sensitive, ls]	361	384	9.6
LRR [sensitive, ls]	385	408	0.51
LRR [sensitive, ls]	385	408	10
LRR [sensitive, ls]	409	430	0.12
LRR [sensitive, ls]	409	430	2.4
LRR [sensitive, ls]	431	452	1.1
LRR [sensitive, ls]	431	452	22
LRR [sensitive, ls]	455	478	0.14
LRR [sensitive, ls]	455	478	2.7
LRR [sensitive, ls]	479	501	0.36
LRR [sensitive, ls]	479	501	7
LRR [sensitive, ls]	502	525	0.18
LRR [sensitive, ls]	502	525	3.5
LRR [sensitive, ls]	526	549	0.0031
LRR [sensitive, ls]	526	549	0.06
LRR [sensitive, ls]	550	573	0.0015
LRR [sensitive, ls]	550	573	0.03
LRR [sensitive, ls]	574	598	0.00098
LRR [sensitive, ls]	574	598	0.019
LRR [sensitive, ls]	599	623	0.2
LRR [sensitive, ls]	599	623	3.9
LRR [sensitive, ls]	647	670	4.7
LRR [sensitive, ls]	647	670	92
LRR [sensitive, ls]	672	695	2.4
LRR [sensitive, ls]	672	695	47
LRR [sensitive, ls]	716	735	0.62
LRR [sensitive, ls]	716	735	12
LRR [sensitive, ls]	738	761	0.011
LRR [sensitive, ls]	738	761	0.22
LRR [sensitive, ls]	762	784	0.026
LRR [sensitive, ls]	762	784	0.51
LRR [sensitive, ls]	800	823	0.94
LRR [sensitive, ls]	800	823	18
LRR [sensitive, ls]	824	848	0.13
LRR [sensitive, ls]	824	848	2.6
LRR [sensitive, ls]	849	872	0.96
LRR [sensitive, ls]	849	872	19
LRR [sensitive, ls]	873	896	0.00067
LRR [sensitive, ls]	873	896	0.013
LRR [sensitive, ls]	932	955	0.21
LRR [sensitive, ls]	932	955	4.2
LRR [sensitive, ls]	956	979	0.029
LRR [sensitive, ls]	956	979	0.57
LRR [sensitive, ls]	980	1003	2.9e-05
LRR [sensitive, ls]	980	1003	0.00058
LRR [sensitive, ls]	1004	1026	0.0019
LRR [sensitive, ls]	1004	1026	0.038

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	35	617	9e-54
CLV2 [A. thaliana]	36	781	5e-51
FLS2 [A.thaliana]	36	870	5e-75
Cf-9 [L. pimpinellifolium]	53	901	7e-58
FLS2 [A.thaliana]	100	802	1e-56
FLS2 [A.thaliana]	109	583	1e-43
Cf-9 [L. pimpinellifolium]	250	1103	2e-62
FLS2 [A.thaliana]	251	1092	7e-77
FLS2 [A.thaliana]	358	1020	3e-59
Xa21 [O. sativa]	364	1061	6e-54
CLV2 [A. thaliana]	389	1087	5e-50
FLS2 [A.thaliana]	474	1020	8e-39
Xa21 [O. sativa]	931	1030	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	1069	1086	out -> in

Report for 5182.m00148

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)