Report for 5182.m00150

 > 5182.m00150, length: 953, copies: 2 

MDVFRCIHVLIALALLLFTPIISNEASANANSTGGCIPSERSALISFKSGLLDPGNLLSSWEGDDCCQWNGVWCN

NETGHIVELNLPGGSCNILPPWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLDLSWS

TFVGTVPPQLGNLSNLRYFSLGSNDNSSLYSTDVSWLSRLSSLEHLDMSLVNLSAVVDWVSVVNKLPSLRFLRLF

GCQLSSTVDSVPNNNLTSLETLDLSLNNFNKRIAPNWFWDLTSLKLLDISDSGFYGPFPNEIGNMTSIVDIDLSG

NNLVGMIPFNLKNLCNLEKFNVAGTNINGNITEIFNRLPRCSWNKLQVLFLPDCNLTGSLPTTLEPLSNLSMLEL

GNNNITGPIPLWIGELSNLTMLGLSSNNLDGVIHEGHLSGLESLDLLILSDNNHIAIKVNSTWVPPFKQITDIEL

RSCQLGPKFPTWLRYLTDVYNLDISNTSISDKVPDWFWKAASSVTHLNMRNNQIAGALPSTLEYMRTIVMDLSSN

KFSGPIPKLPVSLTSLDFSKNNLSGPLPSDIGASALVSLVLYGNSLSGSIPSYLCKMQSLELLDISRNKITGPIS

DCAIDSSSANYTCTNIINISLRKNNLSGQFPSFFKNCKNLVFLDLAENQFSGTLPAWIGEKLPSLVFLRLRSNSF

SGHIPIELTSLAGLQYLDLAHNNFSGCIPNSLAKFHRMTLEQDKEDRFSGAIRHGIGINDNDMVNYIENISVVTK

GQERLYTGEIVYMVNIDLSSNNLTGEIPEEIISLVALTNLNLSWNSLSGQIPEKIGSLSQLESLDLSHNVLSGGI

PSSIASLTYLSHMNLSYNNLSGRIPAGNQLDILEDPASMYVGNIDLCGHPLPNNCSINGDTKIERDDLVNMSFHF

SMIIGFMVGLLLVFYFMLFSRRWRNTCFVFVDGLYDRTYVQVAVTCRRLWRRN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	117	140	0.0049
LRR [Pfam ls]	141	164	0.43
LRR [Pfam ls]	218	242	4.8
LRR [Pfam ls]	243	267	0.21
LRR [Pfam ls]	292	315	1.5
LRR [Pfam ls]	345	368	1.2
LRR [Pfam ls]	369	392	0.31
LRR [Pfam ls]	393	417	1.6
LRR [Pfam ls]	560	583	1.4
LRR [Pfam ls]	584	608	1.9
LRR [Pfam ls]	615	638	8.4
LRR [Pfam ls]	639	663	0.59
LRR [Pfam ls]	664	687	7.5
LRR [Pfam ls]	688	711	0.07
LRR [Pfam ls]	762	785	8.5
LRR [Pfam ls]	786	809	0.66
LRR [Pfam ls]	810	833	0.0025

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	117	140	0.00025
LRR [sensitive, ls]	117	140	0.0049
LRR [sensitive, ls]	141	164	0.022
LRR [sensitive, ls]	141	164	0.43
LRR [sensitive, ls]	218	242	0.24
LRR [sensitive, ls]	218	242	4.8
LRR [sensitive, ls]	243	267	0.01
LRR [sensitive, ls]	243	267	0.21
LRR [sensitive, ls]	268	291	0.93
LRR [sensitive, ls]	268	291	18
LRR [sensitive, ls]	292	315	0.076
LRR [sensitive, ls]	292	315	1.5
LRR [sensitive, ls]	316	339	1.4
LRR [sensitive, ls]	316	339	27
LRR [sensitive, ls]	345	368	0.061
LRR [sensitive, ls]	345	368	1.2
LRR [sensitive, ls]	369	392	0.016
LRR [sensitive, ls]	369	392	0.31
LRR [sensitive, ls]	393	417	0.081
LRR [sensitive, ls]	393	417	1.6
LRR [sensitive, ls]	418	443	4.7
LRR [sensitive, ls]	418	443	92
LRR [sensitive, ls]	444	467	2.8
LRR [sensitive, ls]	444	467	55
LRR [sensitive, ls]	468	491	3.2
LRR [sensitive, ls]	468	491	63
LRR [sensitive, ls]	493	513	0.88
LRR [sensitive, ls]	493	513	17
LRR [sensitive, ls]	516	535	3
LRR [sensitive, ls]	516	535	58
LRR [sensitive, ls]	537	559	1
LRR [sensitive, ls]	537	559	20
LRR [sensitive, ls]	560	583	0.069
LRR [sensitive, ls]	560	583	1.4
LRR [sensitive, ls]	584	608	0.095
LRR [sensitive, ls]	584	608	1.9
LRR [sensitive, ls]	615	638	0.43
LRR [sensitive, ls]	615	638	8.4
LRR [sensitive, ls]	639	663	0.03
LRR [sensitive, ls]	639	663	0.59
LRR [sensitive, ls]	664	687	0.38
LRR [sensitive, ls]	664	687	7.5
LRR [sensitive, ls]	688	711	0.0036
LRR [sensitive, ls]	688	711	0.07
LRR [sensitive, ls]	762	785	0.43
LRR [sensitive, ls]	762	785	8.5
LRR [sensitive, ls]	786	809	0.033
LRR [sensitive, ls]	786	809	0.66
LRR [sensitive, ls]	810	833	0.00013
LRR [sensitive, ls]	810	833	0.0025
LRR [sensitive, ls]	834	856	1.2
LRR [sensitive, ls]	834	856	23

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	10	652	5e-49
CLV2 [A. thaliana]	38	710	7e-56
FLS2 [A.thaliana]	40	918	5e-86
Cf-9 [L. pimpinellifolium]	60	917	2e-80
Xa21 [O. sativa]	247	873	4e-47
CLV2 [A. thaliana]	345	914	1e-54
Xa21 [O. sativa]	494	862	4e-36

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	897	919	out -> in

Report for 5182.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)