Report for 5182.m00151

 > 5182.m00151, length: 862, copies: 2 

MDARPETQKPALLGMAVQRRLATRRPEQQRRRGQRGGWTVGGAGAGTAAFPASAQAQMVVQRELAVDWKLTGGGA

SVGYGGIHVPPMFRWWFRIGRRTTAFPDSRKAYQKMIAPTLLTQRATASAILVFLFVSVAQSASSFHPASTTTVT

RPAVSGSCIPSERKALLTFKDSFWDRAGRLYSWRGEDCCRWKGVRCDNTTGHVVRLDLRNTDEDDWSNGLILSTS

EMSPSIVDLHHLRYLDLSYNHFNFTSIPDFLGSLSNLRYLNLSAANFWGTLPSQLGELPTWIGHLASLSYLDLSE

NMIVGSVPDGTGNLTNLNYLDLSQNSLVGHIPVGIGAFGNLTSLNLGQNSFSGVLAEYHFATLERLEFLDLSSNS

LKLDLHEAWIPPFKLKKGYFESCDLGPQFPSWLRWQTDIVVLDISNTSIKDDLPGWFWTVSYNAYELYLSSNQLG

GALPEKLELPSMQAMDLSDNYLSGKLPANLTVPNLMTLHLHHNQIGGTIPACLCQLRSLRVINLSYNQLTGEIPQ

CSVDQFGFSFLVIDMKNNNLSGEFPSFLQNAGWLLFLDLSYNKLSGNVPTWIAQRMPYLEVLILRSNMFCGNLSN

QLNKLDQLHFLDVAHNNISGSIYSSIRSLTAMKYSHTSGLDNYTGASISMSIKDQELNYTFQSTNNIMLIDMSYN

SFTGPIPRELTLLKGLQSLNLSGNQLSGTIPNDIGILRRLESLDLSYNDLVGEIPSILSDLTFLSCLNLSYNNLS

GRIPSGQQLQTLNNLYMYIGNPGLCGLPLSTNCSTNRTNKIVQNEHDDASHDTTYLYISTSAGFVVGLWIVFCTI

LFKKSWRIAYFQFFDQIYDKIYVQAAVSKAVLIRKFL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	236	260	0.039
LRR [Pfam ls]	261	284	1.1
LRR [Pfam ls]	292	315	0.18
LRR [Pfam ls]	316	339	0.5
LRR [Pfam ls]	340	364	1.3
LRR [Pfam ls]	365	389	1.6
LRR [Pfam ls]	461	481	8.7
LRR [Pfam ls]	484	507	0.6
LRR [Pfam ls]	508	532	0.065
LRR [Pfam ls]	607	630	1.8
LRR [Pfam ls]	690	713	0.011
LRR [Pfam ls]	714	737	0.0068
LRR [Pfam ls]	738	760	3.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	236	260	0.002
LRR [sensitive, ls]	236	260	0.039
LRR [sensitive, ls]	261	284	0.056
LRR [sensitive, ls]	261	284	1.1
LRR [sensitive, ls]	292	315	0.0091
LRR [sensitive, ls]	292	315	0.18
LRR [sensitive, ls]	316	339	0.025
LRR [sensitive, ls]	316	339	0.5
LRR [sensitive, ls]	340	364	0.067
LRR [sensitive, ls]	340	364	1.3
LRR [sensitive, ls]	365	389	0.082
LRR [sensitive, ls]	365	389	1.6
LRR [sensitive, ls]	413	436	1
LRR [sensitive, ls]	413	436	20
LRR [sensitive, ls]	438	458	1.4
LRR [sensitive, ls]	438	458	28
LRR [sensitive, ls]	461	481	0.44
LRR [sensitive, ls]	461	481	8.7
LRR [sensitive, ls]	484	507	0.03
LRR [sensitive, ls]	484	507	0.6
LRR [sensitive, ls]	508	532	0.0033
LRR [sensitive, ls]	508	532	0.065
LRR [sensitive, ls]	534	557	1.9
LRR [sensitive, ls]	534	557	38
LRR [sensitive, ls]	583	606	5.1
LRR [sensitive, ls]	583	606	100
LRR [sensitive, ls]	607	630	0.091
LRR [sensitive, ls]	607	630	1.8
LRR [sensitive, ls]	666	689	1.2
LRR [sensitive, ls]	666	689	23
LRR [sensitive, ls]	690	713	0.00057
LRR [sensitive, ls]	690	713	0.011
LRR [sensitive, ls]	714	737	0.00035
LRR [sensitive, ls]	714	737	0.0068
LRR [sensitive, ls]	738	760	0.19
LRR [sensitive, ls]	738	760	3.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	127	766	8e-54
Xa21 [O. sativa]	156	776	4e-46
CLV2 [A. thaliana]	160	824	5e-66
Cf-9 [L. pimpinellifolium]	179	822	3e-67
FLS2 [A.thaliana]	224	776	1e-50
FLS2 [A.thaliana]	442	794	7e-35

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	805	827	out -> in

Report for 5182.m00151

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)