Report for 5182.m00169

 > 5182.m00169, length: 595, copies: 1 

MDASAASMLWTLIIILAAAAAASSVHPPQQQSYGVGCIAAERAALLSFKEGVMADPLRLLDSWQGAGDCCRWNGV

GCSNRTGHVVKLDLRNTLYWDDQRQVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESL

VYLNLSCIDFFGEVPTQLGNLSRLSYLDVGSMYYSGQIFSSDLSWLGRLSSLKYLDMSGVNLSMVSDWAHVVNML

PNLRVLNLELCQLTRSNPPLLHSNLTVLEKLVLSSNNFYGPLATNWFWGITTLRTLEVEFCSLYGPLPDSLGNMT

ALQVLDMQDNDNITGMFPPTLKNLCNLQEVFTGTNLSGDITEQMERLPKCAWDKLQALNLDATNMTGNLPVWLVN

LTNLKDLSVSGNQLSGPVPLGLGALTKLTILYLGHNNLTGIISEDYLANLCNMVILDLSYTSLEVVVGSTWTPPF

KLIRAQLASCQLGPGFPILFKHQKGIIYIDVSNAGIADAIPSWFWDEISYAFYVDMSHNQIDGELPAKLEARTRQ

ELHLNSNQLKGSIPQLLRNITKLDISRNSLSAPLPSDFQAPELAALVLFSNYIPGSVPLSICDLQIFGYP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	122	148	0.14
LRR [Pfam ls]	277	300	4.1
LRR [Pfam ls]	301	325	1.4
LRR [Pfam ls]	378	401	0.71
LRR [Pfam ls]	402	426	0.11
LRR [Pfam ls]	544	567	1.8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	122	148	0.0071
LRR [sensitive, ls]	122	148	0.14
LRR [sensitive, ls]	149	172	2.9
LRR [sensitive, ls]	149	172	56
LRR [sensitive, ls]	201	222	2.4
LRR [sensitive, ls]	201	222	47
LRR [sensitive, ls]	227	249	2.1
LRR [sensitive, ls]	227	249	40
LRR [sensitive, ls]	252	276	3
LRR [sensitive, ls]	252	276	60
LRR [sensitive, ls]	277	300	0.21
LRR [sensitive, ls]	277	300	4.1
LRR [sensitive, ls]	301	325	0.069
LRR [sensitive, ls]	301	325	1.4
LRR [sensitive, ls]	354	377	1.1
LRR [sensitive, ls]	354	377	22
LRR [sensitive, ls]	378	401	0.036
LRR [sensitive, ls]	378	401	0.71
LRR [sensitive, ls]	402	426	0.0058
LRR [sensitive, ls]	402	426	0.11
LRR [sensitive, ls]	427	451	5.2
LRR [sensitive, ls]	427	451	100
LRR [sensitive, ls]	544	567	0.092
LRR [sensitive, ls]	544	567	1.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	13	591	5e-41
CLV2 [A. thaliana]	41	582	6e-31
FLS2 [A.thaliana]	41	591	2e-33
Cf-9 [L. pimpinellifolium]	62	586	5e-35
Cf-9 [L. pimpinellifolium]	84	417	3e-14
FLS2 [A.thaliana]	109	576	2e-33
CLV2 [A. thaliana]	111	582	2e-27
Cf-9 [L. pimpinellifolium]	112	564	4e-20
CLV2 [A. thaliana]	123	419	3e-11
CLV2 [A. thaliana]	177	590	1e-22
Cf-9 [L. pimpinellifolium]	247	589	1e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5182.m00169

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)