Report for 5300.m00106

 > 5300.m00106, length: 1002, copies: 1 

MVAARRSAASSSFFLLLLVLAVRVRASSDRVQERDRSALLELRGAAGLLGRWPTGSAVADHCSWPGVTCDASRRV

VAVAVAAPPASGSSELAGELSPAVGLLTELRELSLPSRGLRGEIPAEIWRLEKLEVVNLAGNSLHGALPLAFPPR

MRVLDLASNRLHGEIQGTLSDCKSLMRLNLSGNRLTGSVPGVLGSLPKLKLLDLSRNLLTGRIPSELGDCRELRS

LQLFSNLLEGSIPPEIGRLRRLQVLDISSNRLNGPVPMELGNCMDLSVLVLTSQFDAVNLSEFNMFIGGIPESVT

ALPKLRMLWAPRAGFEGNIPSNWGRCHSLEMVNLAENLLSGVIPRELGQCSNLKFLNLSSNKLSGSIDNGLCPHC

IAVFDVSRNELSGTIPACANKGCTPQLLDDMPSRYPSFFMSKALAQPSSGYCKSGNCSVVYHNFANNNLGGHLTS

LPFSADRFGNKILYAFHVDYNNFTGSLHEILLAQCNNVEGLIVSFRDNKISGGLTEEMSTKCSAIRALDLAGNRI

TGVMPGNIGLLSALVKMDISRNLLEGQIPSSFKELKSLKFLSLAENNLSGTIPSCLGKLRSLEVLDLSSNSLSGK

IPRNLVTLTYLTSLLLNNNKLSGNIPDIAPSASLSIFNISFNNLSGPLPLNMHSLACNSIQGNPSLQPCGLSTLA

NTVMKARSLAEGDVPPSDSATVDSGGGFSKIEIASITSASAIVAVLLALIILYIYTRKCASRQSRRSIRRREVTV

FVDIGAPLTYETVVRATGSFNASNCIGSGGFGATYKAEIAPGVLVAIKRLAIGRFQGIQQFQAEVKTLGRCRHPN

LVTLIGYHLSDSEMFLIYNFLPGGNLERFIQERAKRPIDWRMLHKIALDIARALGFLHDSCVPRILHRDVKPSNI

LLDNEYNAYLSDFGLARLLGNSETHATTGVAEYAMTCRVSDKADVYSYGVVLLELISDKKALDPSFSPYGNGFNI

VAWACMLLQKGRAREFFIEGSNGTSEG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	150	173	8.3
LRR [Pfam ls]	174	197	0.056
LRR [Pfam ls]	198	221	0.02
LRR [Pfam ls]	222	245	0.39
LRR [Pfam ls]	246	269	6
LRR [Pfam ls]	352	372	0.88
LRR [Pfam ls]	514	537	1.9
LRR [Pfam ls]	538	561	2.7
LRR [Pfam ls]	562	585	0.14
LRR [Pfam ls]	586	609	0.018
Ser/Thr pkinase [Pfam fs]	770	957	5.6e-36
Ser/Thr pkinase [Pfam ls]	770	992	6.4e-24

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	104	127	2
LRR [sensitive, ls]	104	127	61
LRR [sensitive, ls]	128	148	0.57
LRR [sensitive, ls]	128	148	18
LRR [sensitive, ls]	150	173	0.26
LRR [sensitive, ls]	150	173	8.3
LRR [sensitive, ls]	174	197	0.0018
LRR [sensitive, ls]	174	197	0.056
LRR [sensitive, ls]	198	221	0.00063
LRR [sensitive, ls]	198	221	0.02
LRR [sensitive, ls]	222	245	0.012
LRR [sensitive, ls]	222	245	0.39
LRR [sensitive, ls]	246	269	0.19
LRR [sensitive, ls]	246	269	6
LRR [sensitive, ls]	328	351	0.3
LRR [sensitive, ls]	328	351	9.4
LRR [sensitive, ls]	352	372	0.028
LRR [sensitive, ls]	352	372	0.88
LRR [sensitive, ls]	375	399	0.61
LRR [sensitive, ls]	375	399	19
LRR [sensitive, ls]	476	499	1.8
LRR [sensitive, ls]	476	499	57
LRR [sensitive, ls]	514	537	0.06
LRR [sensitive, ls]	514	537	1.9
LRR [sensitive, ls]	538	561	0.085
LRR [sensitive, ls]	538	561	2.7
LRR [sensitive, ls]	562	585	0.0045
LRR [sensitive, ls]	562	585	0.14
LRR [sensitive, ls]	586	609	0.00057
LRR [sensitive, ls]	586	609	0.018
LRR [sensitive, ls]	610	632	0.42
LRR [sensitive, ls]	610	632	13
LRR [sensitive, ls]	633	664	0.9
LRR [sensitive, ls]	633	664	28

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	36	868	1e-68
FLS2 [A.thaliana]	47	960	4e-97
Cf-9 [L. pimpinellifolium]	62	656	6e-36
Cf-9 [L. pimpinellifolium]	88	626	1e-38
Cf-9 [L. pimpinellifolium]	88	262	1e-13
CLV2 [A. thaliana]	88	303	5e-13
Cf-9 [L. pimpinellifolium]	89	391	3e-29
Cf-9 [L. pimpinellifolium]	89	297	5e-18
CLV2 [A. thaliana]	89	627	8e-43
CLV2 [A. thaliana]	154	662	3e-36
CLV2 [A. thaliana]	175	649	4e-36
Rpg1 [Hordeum vulgare]	760	960	1e-21
Pto [L. esculentum]	761	979	3e-31
Rpg1 [Hordeum vulgare]	767	961	6e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	708	730	out -> in

Report for 5300.m00106

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)