Report for 5322.m00118

 > 5322.m00118, length: 1057, copies: 1 

MGSAAAARTPWALQLGVALAFLLATTCHGLNHEGWLLLTLRKQIVDTFHHLDDWNPEDPSPCGWKGVNCSSGSTP

AVVSLNLSNMNLSGTVDPSIGGLAELTNLDLSFNGFSGTIPAEIGNCSKLTGLNLNNNQFQGTIPAELGKLAMMI

TFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGSIPHTIGRLKNLKTVRLGQNAISGNIPVEIGECLNLVVFG

LAQNKLGGPLPKEIGKLTNMTDLILWGNQLSSVIPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYR

NLLNGTIPLEIGNLSLAEEIDFSENVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTL

SGPIPACFQYMSRLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLILLNLGANKLIGN

IPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGPIPPQIGNCKSLQRLDLTNNYFTSELPQ

EIGNLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSLPNEVGSLPQLELLSFADNRLSGEIPPILG

KLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANL

SSLLEFNVSYNNLTGALPTIPLFDNMASTSFLGNKGLCGGQLGKCGSESISSSQSSNSGSPPLGKVSTKDAYTFQ

ELVSATNNFDESCVIGRGACGTVYRAILKAGQTIAVKKLASNREGSNTDNSFRAEILTLGKIRHRNIVKLYGFIY

HQGSNLLLYEYMPRGSLGELLHGQSSSSLDWETRFMIALGSAEGLSYLHHDCKPRIIHRDIKSNNILLDENFEAH

VGDFGLAKVIDMPYSKSMSAIAGSYGYIAPEYAYTMKVTEKSDIYSYGVVLLELLTGRAPVQPLELGGDLVTWVK

NYIRDNSLGPGILDKNLNLEDKTSVDHMIEVLKIALLCTSMSPYDRPPMRNVVVMLSESRDRARMSSSSSPASDH

SSKKDNL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	100	123	0.071
LRR [Pfam ls]	124	147	0.052
LRR [Pfam ls]	268	291	4.5
LRR [Pfam ls]	292	315	0.039
LRR [Pfam ls]	340	363	6.7
LRR [Pfam ls]	364	387	1.9
LRR [Pfam ls]	412	435	6.3
LRR [Pfam ls]	460	483	0.49
LRR [Pfam ls]	484	507	6.1
LRR [Pfam ls]	508	531	0.019
LRR [Pfam ls]	532	555	5.8
LRR [Pfam ls]	556	579	0.28
LRR [Pfam ls]	580	603	0.14
LRR [Pfam ls]	604	627	1.5
LRR [Pfam ls]	653	676	0.062
LRR [Pfam ls]	677	702	8.4
Ser/Thr pkinase [Pfam fs]	759	960	1.4e-49
Ser/Thr pkinase [Pfam ls]	759	1031	3.2e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	76	99	0.6
LRR [sensitive, ls]	76	99	12
LRR [sensitive, ls]	100	123	0.0035
LRR [sensitive, ls]	100	123	0.071
LRR [sensitive, ls]	124	147	0.0026
LRR [sensitive, ls]	124	147	0.052
LRR [sensitive, ls]	196	219	1
LRR [sensitive, ls]	196	219	21
LRR [sensitive, ls]	220	243	1.7
LRR [sensitive, ls]	220	243	35
LRR [sensitive, ls]	244	267	0.57
LRR [sensitive, ls]	244	267	11
LRR [sensitive, ls]	268	291	0.22
LRR [sensitive, ls]	268	291	4.5
LRR [sensitive, ls]	292	315	0.0019
LRR [sensitive, ls]	292	315	0.039
LRR [sensitive, ls]	316	339	1.7
LRR [sensitive, ls]	316	339	34
LRR [sensitive, ls]	340	363	0.33
LRR [sensitive, ls]	340	363	6.7
LRR [sensitive, ls]	364	387	0.093
LRR [sensitive, ls]	364	387	1.9
LRR [sensitive, ls]	388	411	0.77
LRR [sensitive, ls]	388	411	15
LRR [sensitive, ls]	412	435	0.31
LRR [sensitive, ls]	412	435	6.3
LRR [sensitive, ls]	436	459	0.79
LRR [sensitive, ls]	436	459	16
LRR [sensitive, ls]	460	483	0.024
LRR [sensitive, ls]	460	483	0.49
LRR [sensitive, ls]	484	507	0.3
LRR [sensitive, ls]	484	507	6.1
LRR [sensitive, ls]	508	531	0.00092
LRR [sensitive, ls]	508	531	0.019
LRR [sensitive, ls]	532	555	0.29
LRR [sensitive, ls]	532	555	5.8
LRR [sensitive, ls]	556	579	0.014
LRR [sensitive, ls]	556	579	0.28
LRR [sensitive, ls]	580	603	0.0068
LRR [sensitive, ls]	580	603	0.14
LRR [sensitive, ls]	604	627	0.074
LRR [sensitive, ls]	604	627	1.5
LRR [sensitive, ls]	653	676	0.0031
LRR [sensitive, ls]	653	676	0.062
LRR [sensitive, ls]	677	702	0.42
LRR [sensitive, ls]	677	702	8.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	37	625	2e-63
Xa21 [O. sativa]	51	855	2e-87
Cf-9 [L. pimpinellifolium]	54	723	5e-77
FLS2 [A.thaliana]	62	1038	1e-147
CLV2 [A. thaliana]	155	718	6e-57
Rpg1 [Hordeum vulgare]	738	958	3e-38
Pto [L. esculentum]	747	1028	2e-44
Rpg1 [Hordeum vulgare]	747	1028	3e-27

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5322.m00118

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)