Report for 5335.m00132

 > 5335.m00132, length: 1034, copies: 1 

MISRTCSRLLLSTLAVHLLLLLAIIQHSCSLSTYSSSSSNQTAKVPYCQPDQASALLRLRRRSFSPTNDSACTLA

SWRPGTDCCDWEGVACSTGTGTGGGGGRVTTLDLGGCWLEISAAGLHPALFELTSLRYLDLSENSLNANDSELPA

TGFERLTELTHLNLSYSDFTGNIPRGIPRLSRLASLDLSNWIYLIEADNDYSLPLGAGRWPVVEPDIGSLLANLS

NLRALDLGNVDLSGNGAAWCDGFASSTPRLEVLRLRNTHLDAPICGSLSAIRSLVEINLKFNKLHGRIPDSLADL

PSLRVLRLAYNLLEGPFPMRIFGSKNLRVVDISYNFRLSGVLPDFSSGSALTELLCSNTNLSGPIPSSVSNLKSL

KNLGVAAAGDSHQEELPSSIGELRSLTSLQLSGSGIVGEMPSWVANLTSLETLQFSNCGLSGQLPSFIGNLKNLS

TLKLYACNFSGQVPPHLFNLTNLEVINLHSNGFIGTIELSSFFKLPNLSILNLSNNELSVQVGEHNSSWESIDNF

DTLCLASCNISKLPHTLRHMQSVQVLDLSSNHIHGTIPQWAWDNWINSLILMNLSHNQFSGSIGYGSVISDGMFV

IDISYNLFEGHIPVPGPQTQLFDCSNNRFSSMPSNFGSNLSSISLLMASSNKLSGEIPPSICEATSLLLLDLSNN

DFLGSIPSCLMEDMSDHLNVLNLKGNQLGGRLPNSLKQDCAFGALDFSDNRIEGLLPRSLVACKDLEAFDIRNNR

IDDKFPCWMSMLPKLQVLVLKSNKFVGNVGPSVPGDKNSCEFIKLRIFDLASNNFSGLLQNEWFRTMKSMMTKTV

NETLVMENQYDLLGQTYQITTAITYKGSDITFSKILRTIVVIDVSDNAFYGAIPQSIGDLVLLSGVNMSHNALTG

LIPSQLGMLHQLESLDLSSNDLSGEIPQELASLDFLSTLNMSYNKLEGRIPESPHFLTFSNLSFLGNMGLCGLQL

SKACNNISSDTVLHQSEKVSIDIVLFLFAGLGFGVGFAIAILLTWGTSRSLSLALRLSQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	129	8.3
LRR [Pfam ls]	130	157	0.032
LRR [Pfam ls]	158	181	1.6
LRR [Pfam ls]	278	301	1.5
LRR [Pfam ls]	326	349	5.8
LRR [Pfam ls]	350	373	5.5
LRR [Pfam ls]	400	423	1.5
LRR [Pfam ls]	424	447	0.13
LRR [Pfam ls]	448	471	1.5
LRR [Pfam ls]	472	496	0.085
LRR [Pfam ls]	524	546	9.1
LRR [Pfam ls]	547	571	0.58
LRR [Pfam ls]	666	690	0.76
LRR [Pfam ls]	692	712	6.9
LRR [Pfam ls]	794	818	4.7
LRR [Pfam ls]	911	934	0.026
LRR [Pfam ls]	935	958	2.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	129	0.41
LRR [sensitive, ls]	103	129	8.3
LRR [sensitive, ls]	130	157	0.0016
LRR [sensitive, ls]	130	157	0.032
LRR [sensitive, ls]	158	181	0.079
LRR [sensitive, ls]	158	181	1.6
LRR [sensitive, ls]	226	249	3
LRR [sensitive, ls]	226	249	61
LRR [sensitive, ls]	254	277	1.2
LRR [sensitive, ls]	254	277	25
LRR [sensitive, ls]	278	301	0.076
LRR [sensitive, ls]	278	301	1.5
LRR [sensitive, ls]	302	325	1.9
LRR [sensitive, ls]	302	325	38
LRR [sensitive, ls]	326	349	0.29
LRR [sensitive, ls]	326	349	5.8
LRR [sensitive, ls]	350	373	0.27
LRR [sensitive, ls]	350	373	5.5
LRR [sensitive, ls]	400	423	0.076
LRR [sensitive, ls]	400	423	1.5
LRR [sensitive, ls]	424	447	0.0064
LRR [sensitive, ls]	424	447	0.13
LRR [sensitive, ls]	448	471	0.072
LRR [sensitive, ls]	448	471	1.5
LRR [sensitive, ls]	472	496	0.0042
LRR [sensitive, ls]	472	496	0.085
LRR [sensitive, ls]	497	518	1.1
LRR [sensitive, ls]	497	518	22
LRR [sensitive, ls]	524	546	0.45
LRR [sensitive, ls]	524	546	9.1
LRR [sensitive, ls]	547	571	0.029
LRR [sensitive, ls]	547	571	0.58
LRR [sensitive, ls]	573	595	2.6
LRR [sensitive, ls]	573	595	52
LRR [sensitive, ls]	618	641	0.52
LRR [sensitive, ls]	618	641	10
LRR [sensitive, ls]	642	665	1.1
LRR [sensitive, ls]	642	665	22
LRR [sensitive, ls]	666	690	0.038
LRR [sensitive, ls]	666	690	0.76
LRR [sensitive, ls]	692	712	0.34
LRR [sensitive, ls]	692	712	6.9
LRR [sensitive, ls]	716	739	2.6
LRR [sensitive, ls]	716	739	52
LRR [sensitive, ls]	740	762	6.6
LRR [sensitive, ls]	740	762	130
LRR [sensitive, ls]	764	788	3.6
LRR [sensitive, ls]	764	788	73
LRR [sensitive, ls]	794	818	0.23
LRR [sensitive, ls]	794	818	4.7
LRR [sensitive, ls]	863	886	1.6
LRR [sensitive, ls]	863	886	32
LRR [sensitive, ls]	887	910	1.8
LRR [sensitive, ls]	887	910	37
LRR [sensitive, ls]	911	934	0.0013
LRR [sensitive, ls]	911	934	0.026
LRR [sensitive, ls]	935	958	0.14
LRR [sensitive, ls]	935	958	2.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	16	756	7e-41
Cf-9 [L. pimpinellifolium]	19	777	4e-56
CLV2 [A. thaliana]	34	681	4e-47
FLS2 [A.thaliana]	57	867	4e-57
FLS2 [A.thaliana]	244	972	5e-75
Cf-9 [L. pimpinellifolium]	272	1022	1e-92
Xa21 [O. sativa]	338	807	4e-36
CLV2 [A. thaliana]	354	1031	3e-57
Xa21 [O. sativa]	401	972	2e-47
CLV2 [A. thaliana]	427	952	5e-32
CLV2 [A. thaliana]	505	965	1e-31
Xa21 [O. sativa]	625	970	3e-30
Xa21 [O. sativa]	867	983	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	998	1020	out -> in

Report for 5335.m00132

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)