Report for 5349.m00113

 > 5349.m00113, length: 352, copies: 1 

MREMGEKRRRGHLNPAGFAGGLHDHEEKKNEEHKLDMSGMSMDALPHLTMSLGQVTILDLSNNNLESIPESIIAR

LLNVVVLDVRSNQLKSLPNSIGCLSKLKVLNVSGNLLESLPNTIEECRALEELHANFNELTKLPDTLGFELHSLR

KLSVNSNKLAQLPSSTSHMTALRALDARLNCLRALPDGLENLANLEALNVSQNFQFLRELPYAVGLLASLRELDV

SYNSIAALPDSMGCLTKLARFSAVGNPLVSPPMDVVEQGLDAMRAYLTARMNGGDGKRKKKAWLPKLVKYSTFTA

RMTPGRTRVHENTEGLLMSDYRSLNGIASPRFLTMLSPRRLFSPRRNSPKHC

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	54	77	0.0044
LRR [Pfam ls]	78	100	0.52
LRR [Pfam ls]	101	123	0.11
LRR [Pfam ls]	124	147	6
LRR [Pfam ls]	148	170	1.6
LRR [Pfam ls]	219	241	0.23

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	54	77	0.00022
LRR [sensitive, ls]	54	77	0.0044
LRR [sensitive, ls]	78	100	0.026
LRR [sensitive, ls]	78	100	0.52
LRR [sensitive, ls]	101	123	0.0055
LRR [sensitive, ls]	101	123	0.11
LRR [sensitive, ls]	124	147	0.3
LRR [sensitive, ls]	124	147	6
LRR [sensitive, ls]	148	170	0.081
LRR [sensitive, ls]	148	170	1.6
LRR [sensitive, ls]	171	193	1.8
LRR [sensitive, ls]	171	193	36
LRR [sensitive, ls]	194	218	3.5
LRR [sensitive, ls]	194	218	72
LRR [sensitive, ls]	219	241	0.011
LRR [sensitive, ls]	219	241	0.23

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	44	256	7e-11
Cf-9 [L. pimpinellifolium]	45	280	1e-10
FLS2 [A.thaliana]	51	243	8e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5349.m00113

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)