Report for 5350.m00128

 > 5350.m00128, length: 807, copies: 1 

MATLRFLGLTGNLLSGRIPVSLANISSLSSILLGQNNLSGPIPESLSQIANLNKLDLSGNRLSGFVPVTLYNKSS

LEFFGIGNNSLIGKIPPDIGHTLPNLKSLVMSLNRFDGSIPTSLANASNLQMLDLSSNLLSGLVPALGSLINLNK

LFLGNNRLEAEDWSFFTALTNCTQLLQLSMEGNNLNGSLPKSVGNLSTNFEWFKFGGNQISGRIPDELGNLVNLT

LLDINSNMLSGEIPLTIGNLRKLFILNLSMNKLSGQIPSTIGNLSQLGKLYLDNNNLSGKIPARIGQCKMLNMLN

LSVNSLDGSIPDELVSMSSLSLGLDLSNNKLSGSIPQEVGTLSNLALLNFSNNQLSGQIPSSLGQCVVLLSLNME

GNNLIGNIPPALTSLHAIQRIDLSENNLSSEVPVFFENFISLAHLNLSYNYFEGPIPISGIFQRPNSVSLEGNKG

LCANIHILNLPICPSSPAKTKNNKRLLLKVIPSITIALFSALCLIFALVTLWKRRMISFSWFNYGHRQCTDVLRQ

FSGMLNMLCSSNPKRREVPTTPINNETLKKVSYGDILKATNWFSSVHTISSTHTGSVYVGRFKSDKSLVAIKVFN

LNQPGAYESYFIECEVLRSTRHRNLMRPLTLCSTLDKENHEFKALIFKFMVNGSLERWLYSEQHYGIKDRVLCLG

QRICIATEVASALDYIHNHLTPPLVHCDVKPSNILLDDDMTARLGDFGSAKFLFPDLVSLESLADIGGTIGYIAP

EYGMGCQISTGGDVYSFGVLLLEMLTGKQPTDDTISGWQLAFITLLTPCSQIELQRF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	3	26	4.6
LRR [Pfam ls]	51	74	0.28
LRR [Pfam ls]	75	99	7.1
LRR [Pfam ls]	124	146	0.065
LRR [Pfam ls]	174	197	7.1
LRR [Pfam ls]	223	246	0.17
LRR [Pfam ls]	271	294	1.1
LRR [Pfam ls]	344	367	0.38
LRR [Pfam ls]	368	391	8.2
LRR [Pfam ls]	392	415	5.6
LRR [Pfam ls]	416	437	7.9
Ser/Thr pkinase [Pfam ls]	568	807	3.8e-23
Ser/Thr pkinase [Pfam fs]	580	783	2.6e-37

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	3	26	0.23
LRR [sensitive, ls]	3	26	4.6
LRR [sensitive, ls]	27	50	0.71
LRR [sensitive, ls]	27	50	14
LRR [sensitive, ls]	51	74	0.014
LRR [sensitive, ls]	51	74	0.28
LRR [sensitive, ls]	75	99	0.35
LRR [sensitive, ls]	75	99	7.1
LRR [sensitive, ls]	100	123	2
LRR [sensitive, ls]	100	123	40
LRR [sensitive, ls]	124	146	0.0032
LRR [sensitive, ls]	124	146	0.065
LRR [sensitive, ls]	147	170	1.5
LRR [sensitive, ls]	147	170	31
LRR [sensitive, ls]	174	197	0.35
LRR [sensitive, ls]	174	197	7.1
LRR [sensitive, ls]	199	222	0.69
LRR [sensitive, ls]	199	222	14
LRR [sensitive, ls]	223	246	0.0085
LRR [sensitive, ls]	223	246	0.17
LRR [sensitive, ls]	247	270	0.48
LRR [sensitive, ls]	247	270	9.6
LRR [sensitive, ls]	271	294	0.057
LRR [sensitive, ls]	271	294	1.1
LRR [sensitive, ls]	295	318	2
LRR [sensitive, ls]	295	318	40
LRR [sensitive, ls]	320	343	2.5
LRR [sensitive, ls]	320	343	50
LRR [sensitive, ls]	344	367	0.019
LRR [sensitive, ls]	344	367	0.38
LRR [sensitive, ls]	368	391	0.41
LRR [sensitive, ls]	368	391	8.2
LRR [sensitive, ls]	392	415	0.28
LRR [sensitive, ls]	392	415	5.6
LRR [sensitive, ls]	416	437	0.39
LRR [sensitive, ls]	416	437	7.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	432	7e-44
CLV2 [A. thaliana]	1	448	4e-44
FLS2 [A.thaliana]	1	781	1e-103
Xa21 [O. sativa]	1	678	1e-130
Cf-9 [L. pimpinellifolium]	4	451	1e-48
CLV2 [A. thaliana]	4	313	3e-33
FLS2 [A.thaliana]	4	432	2e-64
FLS2 [A.thaliana]	6	434	5e-67
CLV2 [A. thaliana]	7	432	2e-50
CLV2 [A. thaliana]	7	452	1e-41
Cf-9 [L. pimpinellifolium]	21	449	8e-38
CLV2 [A. thaliana]	30	429	5e-45
FLS2 [A.thaliana]	30	432	2e-52
FLS2 [A.thaliana]	37	432	2e-52
Xa21 [O. sativa]	54	440	3e-51
Cf-9 [L. pimpinellifolium]	167	436	2e-15
Xa21 [O. sativa]	174	488	5e-39
Cf-9 [L. pimpinellifolium]	208	448	6e-16
CLV2 [A. thaliana]	247	432	7e-19
FLS2 [A.thaliana]	299	449	3e-11
Rpg1 [Hordeum vulgare]	559	779	2e-12
Pto [L. esculentum]	560	778	8e-19
Rpg1 [Hordeum vulgare]	565	779	1e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	480	502	out -> in

Report for 5350.m00128

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)