Report for 5350.m00130

 > 5350.m00130, length: 936, copies: 1 

MKKKKTIDLKSLWERSTKSQKVASTSDPKPLTNESEVQIPENAPSSPIQLLLEAPNAHDSDMSPSVQLEIDILTI

VLLTAILAAAQSNKSESDRKALLCFKSGILLDLDGVLSSWMDDSLNFCSWRGVTCSSSYPSRVVHLELSSSHLTG

RISGCIGNLTSLSQINLTDNHLSGAIPDELGKLPVLRTLLLAANNLEGDIPDSLGTSLSLSYVNLANNTLTGVIP

DSLASSPSLNMLILSRNNLSGQIPAKLFSNSSKLTIACLGNNRLVGQIPSDIGNSLPKLQILKFQNSKFEGQIPT

SLSNATNLIQLDLSNNLMHGSIPSLGLLANLNQVRLGKNSLEADHWAFLASMENCTELIELSLQWNLLDGILPSS

VSNISTNLQALVLRGNQISGRIPSTIGKLHNLYILDLSINKLSGQIPSTIGNISHLGHFFLDDNNLSGNIPISIW

QCTELLELNFSINDLSGLIPSDLSSSPFYSRGSTLLVVDFSHNNLTGQIPESFGSNNMQQVNLSRNELSGPLPEF

FRRMTMLELLDLSYNNFEGPIPTDCFFQNTSAVFLEGNKKLYSKSSTVSFPICGSTSDSTKSNNEASLTKKIHLP

LQCSDLFKRCNYVLNWCSGMPSMLGLPQPKRRRVPIPPSNNGTLKKVSYSDIIKATNWFSSNHKISSTQTGSIYV

GRFKSEKRLVAIKVFNLNQPGAYESYFIECEVLRSTRHRNIMRPLTLCSTLDHENHEFKALIFKFMVNGSLERWL

HSEQHNGIPDRVLCLGQRISIATDVATALDYIHNHVMPPLVHCDLKPSNILLDVDITALLGDFGSAKFLFPDLVS

PESLADIGGTIGYIAPGKQPTDDTFADGVSIHNFVDSMFPDRVAEILDPYMTHEEHQVYTAEWLEACIKPLVALG

LSCSMVSSKDRPGMQDVCAKLCAVKETFLQFGDFSL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	137	160	8.3
LRR [Pfam ls]	161	184	0.21
LRR [Pfam ls]	209	232	0.19
LRR [Pfam ls]	233	257	0.09
LRR [Pfam ls]	307	329	1.3
LRR [Pfam ls]	382	405	0.25
LRR [Pfam ls]	406	429	2.4
LRR [Pfam ls]	454	477	6.9
LRR [Pfam ls]	507	530	0.45
LRR [Pfam ls]	531	555	2.8
Ser/Thr pkinase [Pfam ls]	659	923	4e-13
Ser/Thr pkinase [Pfam fs]	671	841	2.9e-22

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	137	160	0.41
LRR [sensitive, ls]	137	160	8.3
LRR [sensitive, ls]	161	184	0.011
LRR [sensitive, ls]	161	184	0.21
LRR [sensitive, ls]	185	205	1.5
LRR [sensitive, ls]	185	205	30
LRR [sensitive, ls]	209	232	0.0095
LRR [sensitive, ls]	209	232	0.19
LRR [sensitive, ls]	233	257	0.0045
LRR [sensitive, ls]	233	257	0.09
LRR [sensitive, ls]	258	282	1.3
LRR [sensitive, ls]	258	282	27
LRR [sensitive, ls]	283	306	0.86
LRR [sensitive, ls]	283	306	17
LRR [sensitive, ls]	307	329	0.066
LRR [sensitive, ls]	307	329	1.3
LRR [sensitive, ls]	357	380	1
LRR [sensitive, ls]	357	380	21
LRR [sensitive, ls]	382	405	0.013
LRR [sensitive, ls]	382	405	0.25
LRR [sensitive, ls]	406	429	0.12
LRR [sensitive, ls]	406	429	2.4
LRR [sensitive, ls]	430	453	1.6
LRR [sensitive, ls]	430	453	31
LRR [sensitive, ls]	454	477	0.34
LRR [sensitive, ls]	454	477	6.9
LRR [sensitive, ls]	484	504	0.5
LRR [sensitive, ls]	484	504	10
LRR [sensitive, ls]	507	530	0.022
LRR [sensitive, ls]	507	530	0.45
LRR [sensitive, ls]	531	555	0.14
LRR [sensitive, ls]	531	555	2.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	32	274	1e-15
FLS2 [A.thaliana]	72	549	2e-67
Xa21 [O. sativa]	72	770	1e-110
CLV2 [A. thaliana]	75	551	2e-47
CLV2 [A. thaliana]	107	546	2e-42
Cf-9 [L. pimpinellifolium]	114	547	2e-34
Cf-9 [L. pimpinellifolium]	118	561	6e-38
Cf-9 [L. pimpinellifolium]	120	546	2e-34
FLS2 [A.thaliana]	131	841	3e-79
Cf-9 [L. pimpinellifolium]	133	566	5e-39
FLS2 [A.thaliana]	136	575	2e-51
CLV2 [A. thaliana]	137	426	8e-17
CLV2 [A. thaliana]	138	469	1e-24
FLS2 [A.thaliana]	138	564	8e-55
CLV2 [A. thaliana]	141	429	4e-25
Cf-9 [L. pimpinellifolium]	227	564	9e-23
CLV2 [A. thaliana]	345	552	7e-13
Pto [L. esculentum]	639	921	2e-12
Rpg1 [Hordeum vulgare]	656	841	3e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5350.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)