Report for 5387.m00154

 > 5387.m00154, length: 497, copies: 1 

MAMQVSKKSRLAAPSALLLLLVVAALLPPPRAEAGHDGAGGDDEPPPTPCSPADRAALLGFKAGVTVDTTGILAT

WDGGNDCCGAWEGVSCDAATGRVVALQLEAPPLPPPRRSYMEGALSASLGGLEFLETLVIRDMARIGGAIPASLS

RLSRLKQLYLEGSMLAGGVPGSVLSGMASLQYLSLAGNRFEGKLPPELGSLPGLVQINLAGNRLSGEVPPSYKNL

SRLAYLDLSNNLLSGAIPAFFGQQLKSLAMLDLSNNGFSGEIPASLNLLVGSIPESLFGLQKLWNLNLSRNGLSG

SLPPGIRHGLPSLVSMDLSHNHLVGGIDHFFRSISPARRLTKNASSDMSVIFLPRQLQHLDLSKNSITGALPEFG

AGASLRWLDVSGNAIGGQIPSSVWRLVGLQRLDISRNKIRGTIPASVASMASLRWLDISGNALVGRIPDSFARMA

RLRHASFRGNKLCGKIPQARPFNLLPAAAYAGNLCLCGKPLPPCRQI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	154	178	6.8
LRR [Pfam ls]	179	202	0.0067
LRR [Pfam ls]	203	226	2
LRR [Pfam ls]	227	251	0.25
LRR [Pfam ls]	252	275	0.47
LRR [Pfam ls]	287	311	2.6
LRR [Pfam ls]	312	335	4.4
LRR [Pfam ls]	356	378	0.49
LRR [Pfam ls]	379	402	1.1
LRR [Pfam ls]	403	426	0.41
LRR [Pfam ls]	427	450	0.079

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	129	153	6.7
LRR [sensitive, ls]	129	153	130
LRR [sensitive, ls]	154	178	0.34
LRR [sensitive, ls]	154	178	6.8
LRR [sensitive, ls]	179	202	0.00033
LRR [sensitive, ls]	179	202	0.0067
LRR [sensitive, ls]	203	226	0.099
LRR [sensitive, ls]	203	226	2
LRR [sensitive, ls]	227	251	0.013
LRR [sensitive, ls]	227	251	0.25
LRR [sensitive, ls]	252	275	0.023
LRR [sensitive, ls]	252	275	0.47
LRR [sensitive, ls]	287	311	0.13
LRR [sensitive, ls]	287	311	2.6
LRR [sensitive, ls]	312	335	0.22
LRR [sensitive, ls]	312	335	4.4
LRR [sensitive, ls]	356	378	0.025
LRR [sensitive, ls]	356	378	0.49
LRR [sensitive, ls]	379	402	0.053
LRR [sensitive, ls]	379	402	1.1
LRR [sensitive, ls]	403	426	0.02
LRR [sensitive, ls]	403	426	0.41
LRR [sensitive, ls]	427	450	0.0039
LRR [sensitive, ls]	427	450	0.079

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	467	1e-47
CLV2 [A. thaliana]	52	467	3e-39
FLS2 [A.thaliana]	57	466	1e-43
Cf-9 [L. pimpinellifolium]	75	469	2e-27
Xa21 [O. sativa]	108	488	1e-33
Cf-9 [L. pimpinellifolium]	112	491	7e-29
FLS2 [A.thaliana]	113	494	4e-40
FLS2 [A.thaliana]	116	468	1e-31
Xa21 [O. sativa]	116	469	1e-24
Xa21 [O. sativa]	118	327	2e-21
CLV2 [A. thaliana]	127	487	6e-23
CLV2 [A. thaliana]	128	483	7e-27
CLV2 [A. thaliana]	133	418	1e-21
Xa21 [O. sativa]	148	468	2e-30
FLS2 [A.thaliana]	183	469	2e-27
FLS2 [A.thaliana]	204	469	3e-23
Xa21 [O. sativa]	354	469	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5387.m00154

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)