Report for 5391.m00158

 > 5391.m00158, length: 796, copies: 1 

MTTRRCLCGALQEMSLLSHFCLCLQRKAGSCCRCIRFLHVFVFVLHIHGGHSQMCDPADLASLLAFSDGLDRMGA

GLVGWGPNDTSCCSWTGISCDLGRVVELDLSNRSLSRNSFRGVAVAQLGRLPCLRRLDLSTNGLVGAFPASGFPA

IEVVNVSSNGFTGPHPAFPGAPNLTVLDITGNAFSGGINVTALCASPVKVLRFSANAFSGDVPAGFGQCKLLNDL

FLDGNGLTGSLPKDLYTIPELRWLSLQENQLSGSLDKALGNLSKLTLIDLSYNMFNGNIPDVFGKLRSLESLNLA

SNQLNGTLPLSLSSCPMLRVVSLRNNSLSGEITIDCRLLTRLNNFDAGTNTLRGAIPTRLASCTELRTLNLARNK

LQGELPESFKNLTSLSYLSLTGNGFTNLSSALQVLQHLPNLTSLVLTNNFRGGETMPMDGIEGFKRMQVLVLANC

ALLGTVPPWLQSLKSLSVLDISWNNLHGEIPPWLGNLDSLFYIDLSNNSFSGELPATFTQMKSLISSNGSSGQAS

TGDLPLSFVKKNSTSTGKGLQYNQLSSFPSSLILSNNKLVGSILPSFGRLVKLHVLDLGFNNFSGPIPDELSNMS

SLEVLDLAHNDLSGSIPSSLTKLNFLSKFDVSYNNLSGDVPAGGQFSTFTEEEFAGNPALCRSQSQSCYKRAVTT

EMSSETRFTFGLFLTVEAGFAFGLLTVWNVLFFASSWRAAYFQMVDNFFDRFIFMLKYWFFGGVVYYSTLGDALL

VGGRRLRWLSAGLGRNLQASFWAVLFSAYLRLWANEGPIQTKSEMA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	128	149	8.3
LRR [Pfam ls]	173	197	0.59
LRR [Pfam ls]	245	268	0.26
LRR [Pfam ls]	269	292	0.051
LRR [Pfam ls]	293	316	0.69
LRR [Pfam ls]	365	388	0.002
LRR [Pfam ls]	389	411	0.26
LRR [Pfam ls]	441	464	7.7
LRR [Pfam ls]	465	488	0.18
LRR [Pfam ls]	489	512	0.25
LRR [Pfam ls]	577	600	0.041
LRR [Pfam ls]	601	624	0.0071

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	99	124	4.8
LRR [sensitive, ls]	99	124	97
LRR [sensitive, ls]	128	149	0.41
LRR [sensitive, ls]	128	149	8.3
LRR [sensitive, ls]	150	172	0.62
LRR [sensitive, ls]	150	172	13
LRR [sensitive, ls]	173	197	0.029
LRR [sensitive, ls]	173	197	0.59
LRR [sensitive, ls]	221	244	0.76
LRR [sensitive, ls]	221	244	15
LRR [sensitive, ls]	245	268	0.013
LRR [sensitive, ls]	245	268	0.26
LRR [sensitive, ls]	269	292	0.0025
LRR [sensitive, ls]	269	292	0.051
LRR [sensitive, ls]	293	316	0.034
LRR [sensitive, ls]	293	316	0.69
LRR [sensitive, ls]	317	343	0.83
LRR [sensitive, ls]	317	343	17
LRR [sensitive, ls]	365	388	0.0001
LRR [sensitive, ls]	365	388	0.002
LRR [sensitive, ls]	389	411	0.013
LRR [sensitive, ls]	389	411	0.26
LRR [sensitive, ls]	415	440	1.7
LRR [sensitive, ls]	415	440	34
LRR [sensitive, ls]	441	464	0.38
LRR [sensitive, ls]	441	464	7.7
LRR [sensitive, ls]	465	488	0.0089
LRR [sensitive, ls]	465	488	0.18
LRR [sensitive, ls]	489	512	0.012
LRR [sensitive, ls]	489	512	0.25
LRR [sensitive, ls]	553	576	1.4
LRR [sensitive, ls]	553	576	29
LRR [sensitive, ls]	577	600	0.002
LRR [sensitive, ls]	577	600	0.041
LRR [sensitive, ls]	601	624	0.00035
LRR [sensitive, ls]	601	624	0.0071
LRR [sensitive, ls]	625	647	2
LRR [sensitive, ls]	625	647	40

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	37	661	1e-55
FLS2 [A.thaliana]	38	682	2e-57
FLS2 [A.thaliana]	59	641	3e-58
Xa21 [O. sativa]	59	661	1e-57
Cf-9 [L. pimpinellifolium]	85	660	6e-52
CLV2 [A. thaliana]	177	700	2e-43
FLS2 [A.thaliana]	244	642	3e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	686	708	out -> in
putative TM domain	729	751	in -> out
putative TM domain	761	783	out -> in

Report for 5391.m00158

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)