Report for 5414.m00203

 > 5414.m00203, length: 505, copies: 1 

MDPAPQAHPILSYVLSRLPTLAKARPAGGGGDFDIEQPPVHTPSPRTPSTAGEFELVERMPGLRHPSVLRAMTRA

VADVSAARSALQVLGPRPDHELVDSSRAIVAATDAEAGGSRRVPEGDLEACRAVVRLEETHDAYEALLQEAEGRL

EAVYRSAMEGKDLEEPDGRDESAAAAAGDDAAVQEEVIAVLRQAEEGKPVESVRLVDRQLRHLPEAFGRIQGLRV

LDVSRNQLEVIPDAIGGLDHLEELRLASNALISLPDSIGLLLNLRILNVGSNRLRSLPDSISKCRSLIELDASYN

GLAYLPTNIGYELVNLRKLWVHMNKLRSLPSSICEMRSLYLLDAHFNELCGLPSAIGKLSSLEILNLSSNFSDLK

DLPASFGDLLNLRELDLSNNQIHALPDNFGRLDKLEKLNLEQNPLSMPPMEIVNKGVDAVKEYMLQRWLDILLEE

ERKSIAAAESPQAPTTPSAWLARSVSWVSDVSGSLVGYLSGENKTEKDAYLDQQY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	222	244	0.053
LRR [Pfam ls]	245	267	4.2
LRR [Pfam ls]	268	290	0.14
LRR [Pfam ls]	338	360	3.4
LRR [Pfam ls]	361	385	2.9
LRR [Pfam fs]	386	408	8.1e-05
LRR [Pfam ls]	386	408	0.0014

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	222	244	0.0026
LRR [sensitive, ls]	222	244	0.053
LRR [sensitive, ls]	245	267	0.21
LRR [sensitive, ls]	245	267	4.2
LRR [sensitive, ls]	268	290	0.0067
LRR [sensitive, ls]	268	290	0.14
LRR [sensitive, ls]	291	314	0.99
LRR [sensitive, ls]	291	314	20
LRR [sensitive, ls]	315	337	0.65
LRR [sensitive, ls]	315	337	13
LRR [sensitive, ls]	338	360	0.17
LRR [sensitive, ls]	338	360	3.4
LRR [sensitive, ls]	361	385	0.14
LRR [sensitive, ls]	361	385	2.9
LRR [sensitive, ls]	386	408	7.1e-05
LRR [sensitive, ls]	386	408	0.0014
LRR [sensitive, ls]	409	432	1.8
LRR [sensitive, ls]	409	432	37

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	200	421	3e-15
Cf-9 [L. pimpinellifolium]	213	420	6e-11
FLS2 [A.thaliana]	213	423	3e-11
N [N. glutinosa]	222	453	6e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End
putative coiled-coil	127	153

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5414.m00203

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)