Report for 5422.m00143

 > 5422.m00143, length: 918, copies: 1 

MATTAAAANLLLFSAVLLLATPSNAASAAAPAVAAMPVQPQELLLSFRSSLNDPSGALSTWSRSTPYCNWSHVTC

TAGGGGGGVAVGLSLQGLGLSGDIAAEPLCRVPGLAALSLASNTFNQTVPLQLSRCALLVSLNLSSAGLWGPLPD

QLAMLASLASLDLSGNDIEGQVPPGLAALRGLQVLDLGGNRLSGVLHPALFRNLTKLHFLDLSKNQFLESELPPE

LGEMAGLRWLFLQGSGFGGAIPETLLQLEQLEVLDLSMNSLTGALPPAFGHNFRKLLSLDLSQNGFSGPFPKEIG

KCVMLQRFQVQGNGFTGELPAGLWSLPDLRVVRAESNRFSGRLPELSAAASRLEQVQVDNNSISGEIPRSIGMVR

TMYRFTASANRLAGGLPDTLCDSPAMSIINVSGNALSGAIPELTRCRRLVSLSLSGNALTGPIPASLGGLPVLTY

IDVSSNGLTGAIPAELQGLKLALLNVSYNHLTGRVPPSLVSGALPAVFLQGNPGLCGLPADGGCDAPAAPPSRNR

LALAATVASFVTGVLLLLALGAFAVCRRLHAAAKLVLFYPIKITADELLAALRDKNAIGRGAFGKVYLIELQDGQ

NIAVKKFICSSNQTFGAVKNHMKTFAKIRHKNIARLLGFCYDSHGGGGEVSVIYEHLRMGSLQDLIRAPKFAVGW

NDRLRIAIGVAEGLVYLHRDYTPRFLHRDLKSSNVLLGDDFEPRVTGFGIDRVVGEKAYRSSLASDLNYSCYIAP

VIHFTQKQNFIRIAISTAELHSRFHKTLALCALIPLKLFALLLKPEVNCTKKPTHLMDVYSFGVILLELITGKPA

GQPASDDSVDIVRWVRRRVNVAGGAAQILDPAAAVSHAAQQGMQAALELALLCTSVMPDQRPAMDEVVRSLQLLH

SPQTLPPPPPFTGVAVEP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	157	180	0.03
LRR [Pfam ls]	181	205	0.002
LRR [Pfam ls]	206	230	2.8
LRR [Pfam ls]	255	279	1.3
LRR [Pfam ls]	423	446	0.0058
LRR [Pfam ls]	470	494	1.6
Ser/Thr pkinase [Pfam fs]	577	725	2.7e-28
Ser/Thr pkinase [Pfam ls]	577	898	2.8e-27
Ser/Thr pkinase [Pfam fs]	808	837	0.0032

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	157	180	0.0015
LRR [sensitive, ls]	157	180	0.03
LRR [sensitive, ls]	181	205	0.0001
LRR [sensitive, ls]	181	205	0.002
LRR [sensitive, ls]	206	230	0.14
LRR [sensitive, ls]	206	230	2.8
LRR [sensitive, ls]	231	254	1.1
LRR [sensitive, ls]	231	254	23
LRR [sensitive, ls]	255	279	0.065
LRR [sensitive, ls]	255	279	1.3
LRR [sensitive, ls]	280	303	0.77
LRR [sensitive, ls]	280	303	15
LRR [sensitive, ls]	304	327	0.97
LRR [sensitive, ls]	304	327	19
LRR [sensitive, ls]	328	350	5.2
LRR [sensitive, ls]	328	350	110
LRR [sensitive, ls]	352	376	1.7
LRR [sensitive, ls]	352	376	35
LRR [sensitive, ls]	400	422	2.1
LRR [sensitive, ls]	400	422	43
LRR [sensitive, ls]	423	446	0.00029
LRR [sensitive, ls]	423	446	0.0058
LRR [sensitive, ls]	447	467	0.75
LRR [sensitive, ls]	447	467	15
LRR [sensitive, ls]	470	494	0.079
LRR [sensitive, ls]	470	494	1.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	8	485	3e-43
Xa21 [O. sativa]	10	664	7e-54
FLS2 [A.thaliana]	32	489	6e-50
Cf-9 [L. pimpinellifolium]	60	490	8e-27
FLS2 [A.thaliana]	86	492	9e-51
Cf-9 [L. pimpinellifolium]	88	369	1e-14
FLS2 [A.thaliana]	88	510	1e-46
FLS2 [A.thaliana]	95	899	5e-78
Cf-9 [L. pimpinellifolium]	107	520	1e-32
Cf-9 [L. pimpinellifolium]	110	468	9e-26
CLV2 [A. thaliana]	110	515	6e-38
Cf-9 [L. pimpinellifolium]	185	502	3e-22
CLV2 [A. thaliana]	218	507	5e-25
CLV2 [A. thaliana]	259	486	3e-20
Pto [L. esculentum]	579	897	5e-25
Rpg1 [Hordeum vulgare]	579	728	5e-19
Rpg1 [Hordeum vulgare]	583	896	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	528	550	out -> in

Report for 5422.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)