Report for 5501.m00158

 > 5501.m00158, length: 816, copies: 1 

MSCSFPWGSFCFFLVVLCLPDSNISTSSHGCFVEERTALMDIGSSLTRSNGTAPRSWGRGDDCCLWERVNCSNIT

GRVSHLYFSNLYDSNEVLDALGHSFWRFDTTVFSSFPELQFLDLSMNNATFQSWDVFESLRNLRELDLSSNRLNG

SIPSSLFSLPRLEHLSLSQNLFEGSIPVTLSSNITSALKTFNFSMNNLSGEFSFFWLRNLTKLQKIDVSGNANLV

VAVNFPSWSPSFQLKVLVLSGCNLDKNIVREPIFLRTQHQLEVLDLSNNSLSGSMPNWLFTEQATLVYLNLGNNS

LTGSLGPIWYPQMNLQAISLPMNRISGHLPANISSVFPNMSFLDVSSNTISGEIPSSLCNITRMEYLDLSNNSLS

GELPNCLLTEYPILTTLKVSNNKLGGPIFGGTNHLSIKHALYLDGNKFEGTLPRYLTADFDAHGTLDLHDNNLSG

KLDFSQWNLSTLCTLSLAGNSLIGEIHPSICNLTRIMLLDLSHNNLSGAIPNCMTALELDFFIVSHNSLSGHIVP

FSFFNSSTVMALDLSHNQFNGNIEWVQYLGESKYLSLGSNKFEGQISPSLCQLQSLRILDFSHNSLSGPLPSCIG

NLSFGQNPVGIPLWSLICENHFRYPIFDYIGCYEERGFSFRTKGNIYIYKHNFINWMSGIDLSANMLSGQIPREL

GNLGHIKALNLSYNFFAGPIPATFASMSSVESLDLSHNKLSGAIPWQLTRLSSLSVFSVMYNNLSGCIPNSGQFG

SFDMDSYQGNNLLHPASEGSECAPSSGHSLPDDGDGKGNDPILYAVTAASFVVTFWITFAFTSFRM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	137	160	0.003
LRR [Pfam ls]	161	185	0.84
LRR [Pfam ls]	265	289	0.12
LRR [Pfam ls]	290	312	4.2
LRR [Pfam ls]	339	362	2.8
LRR [Pfam ls]	363	387	0.11
LRR [Pfam ls]	461	484	8
LRR [Pfam ls]	485	505	6.2
LRR [Pfam ls]	580	603	0.053
LRR [Pfam ls]	680	703	4.4
LRR [Pfam ls]	704	727	0.11

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	137	160	0.00015
LRR [sensitive, ls]	137	160	0.003
LRR [sensitive, ls]	161	185	0.042
LRR [sensitive, ls]	161	185	0.84
LRR [sensitive, ls]	187	211	4.1
LRR [sensitive, ls]	187	211	82
LRR [sensitive, ls]	212	234	1.5
LRR [sensitive, ls]	212	234	29
LRR [sensitive, ls]	238	261	3
LRR [sensitive, ls]	238	261	60
LRR [sensitive, ls]	265	289	0.0059
LRR [sensitive, ls]	265	289	0.12
LRR [sensitive, ls]	290	312	0.21
LRR [sensitive, ls]	290	312	4.2
LRR [sensitive, ls]	314	338	2
LRR [sensitive, ls]	314	338	41
LRR [sensitive, ls]	339	362	0.14
LRR [sensitive, ls]	339	362	2.8
LRR [sensitive, ls]	363	387	0.0054
LRR [sensitive, ls]	363	387	0.11
LRR [sensitive, ls]	388	411	2.1
LRR [sensitive, ls]	388	411	43
LRR [sensitive, ls]	461	484	0.4
LRR [sensitive, ls]	461	484	8
LRR [sensitive, ls]	485	505	0.31
LRR [sensitive, ls]	485	505	6.2
LRR [sensitive, ls]	508	530	1.2
LRR [sensitive, ls]	508	530	25
LRR [sensitive, ls]	533	555	5.8
LRR [sensitive, ls]	533	555	120
LRR [sensitive, ls]	556	579	2.8
LRR [sensitive, ls]	556	579	57
LRR [sensitive, ls]	580	603	0.0026
LRR [sensitive, ls]	580	603	0.053
LRR [sensitive, ls]	680	703	0.22
LRR [sensitive, ls]	680	703	4.4
LRR [sensitive, ls]	704	727	0.0056
LRR [sensitive, ls]	704	727	0.11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	14	379	4e-13
CLV2 [A. thaliana]	36	776	5e-57
Cf-9 [L. pimpinellifolium]	56	761	3e-73
FLS2 [A.thaliana]	114	763	6e-57
Xa21 [O. sativa]	114	379	9e-17
FLS2 [A.thaliana]	134	760	4e-56
Xa21 [O. sativa]	140	720	6e-42
Xa21 [O. sativa]	261	746	2e-38
Xa21 [O. sativa]	326	746	4e-31
FLS2 [A.thaliana]	350	754	1e-26
FLS2 [A.thaliana]	431	746	9e-21
Xa21 [O. sativa]	441	746	1e-19
FLS2 [A.thaliana]	654	762	6e-12
Xa21 [O. sativa]	654	762	4e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	792	814	out -> in

Report for 5501.m00158

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)