Report for 5531.m00139

 > 5531.m00139, length: 977, copies: 1 

MAALSSWNQGSSVCSWAGVRCNRQGRVSMLDVQNLNLAGQISPDIGNLSALQSIYLQKNRFIGNIPDQLGRLSLL

ETLNGSSNHFSGSIPSGLTNCTHLVTMDLSANSITGMIPISLHSLQNLKILKLGQNQLTGAIPPSLGNMSLLTTL

DASTNTIAGEIPEELGHLRHLQYFDLSINNLTGTVPRQLYNISNLAFFAVAMNKLHGEIPNDISLGLPKLHIFIV

CYNKLTGQIPPSLHNITKIHSIRISHNFLTGKVPPGLQRLSKLVWYNIGFNQIVHTTSILDDLTNSTKLEYLGIY

ENQIVGKIPDSIGNLSSSLENLYIGGNRITGHIPPMIGRLTRLTLLNMTDNLLDGEIPLEISYLKDLNVLGLSGN

NLSGPIPTQFGNLTALTMLDISKNRLVSSIPKELGHLSHILSLDFSCNKLNGSIPDTIFSLTSLSSILNMSYNAL

TGVIPESIGRLGNIVSIDLSYNLLDGSIPTSVGKCQSVQSLSVCGNAISGVIPREIENLKGLQILDLSNNQLVGG

IPEGLEKLQALQKLNLSFNNLKGLVPSGGIFKNNSAADIHGNRELYNMESTVFRSYSKHHRKLVVVLAVPIASTV

ILLIFVGVMFMLWKSKYLRIDATKVGTAVDDSILKRKLYPLISYEELYHATENFNERNLVGIGSFSSVYKAVLHA

TSPFAVKVLDLNKIGATNSWVAECEILSTIRHRNLVKLVTLCSSIDFSGNEFRALVYEFMTNGSLEDWIHGPRRH

EDSERGLSAVEVLSIAIDIASALEYMHDGSCRAGQVVHCDIKPSNVLLDGDMTAKIGDFGLARLHTQTSARDEES

VSTTHNMKGTIGYIPPEYGYGAKTSTSGDVYSYGIMLLEMITGKSPVDQMFGGEMNLEKWVRASIPHQADEVVDK

RFMMTGSEESSADGQQQQQVDTVDSKLLLETLLVPMVDVALCCVRESPDSRISMHDALSRLKRINEKIFKSLAVS

TP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	121	4.6
LRR [Pfam ls]	122	145	0.091
LRR [Pfam ls]	146	169	7.9
LRR [Pfam ls]	170	193	6.5
LRR [Pfam ls]	243	266	0.57
LRR [Pfam ls]	293	316	0.32
LRR [Pfam ls]	318	341	0.034
LRR [Pfam ls]	342	365	4.3
LRR [Pfam ls]	366	389	0.24
LRR [Pfam ls]	390	413	0.58
LRR [Pfam ls]	414	437	4.6
LRR [Pfam ls]	463	486	7.8
LRR [Pfam ls]	487	510	3.6
LRR [Pfam ls]	511	534	0.0046
LRR [Pfam ls]	535	557	3.8
Ser/Thr pkinase [Pfam fs]	654	874	1.2e-45
Ser/Thr pkinase [Pfam ls]	654	963	2e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	26	49	2.1
LRR [sensitive, ls]	26	49	43
LRR [sensitive, ls]	50	73	0.74
LRR [sensitive, ls]	50	73	15
LRR [sensitive, ls]	98	121	0.23
LRR [sensitive, ls]	98	121	4.6
LRR [sensitive, ls]	122	145	0.0045
LRR [sensitive, ls]	122	145	0.091
LRR [sensitive, ls]	146	169	0.39
LRR [sensitive, ls]	146	169	7.9
LRR [sensitive, ls]	170	193	0.32
LRR [sensitive, ls]	170	193	6.5
LRR [sensitive, ls]	219	242	0.86
LRR [sensitive, ls]	219	242	17
LRR [sensitive, ls]	243	266	0.028
LRR [sensitive, ls]	243	266	0.57
LRR [sensitive, ls]	293	316	0.016
LRR [sensitive, ls]	293	316	0.32
LRR [sensitive, ls]	318	341	0.0017
LRR [sensitive, ls]	318	341	0.034
LRR [sensitive, ls]	342	365	0.21
LRR [sensitive, ls]	342	365	4.3
LRR [sensitive, ls]	366	389	0.012
LRR [sensitive, ls]	366	389	0.24
LRR [sensitive, ls]	390	413	0.029
LRR [sensitive, ls]	390	413	0.58
LRR [sensitive, ls]	414	437	0.23
LRR [sensitive, ls]	414	437	4.6
LRR [sensitive, ls]	439	462	2.5
LRR [sensitive, ls]	439	462	50
LRR [sensitive, ls]	463	486	0.39
LRR [sensitive, ls]	463	486	7.8
LRR [sensitive, ls]	487	510	0.18
LRR [sensitive, ls]	487	510	3.6
LRR [sensitive, ls]	511	534	0.00023
LRR [sensitive, ls]	511	534	0.0046
LRR [sensitive, ls]	535	557	0.19
LRR [sensitive, ls]	535	557	3.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	552	6e-87
CLV2 [A. thaliana]	3	551	3e-62
Xa21 [O. sativa]	3	758	1e-137
Cf-9 [L. pimpinellifolium]	6	542	1e-53
Cf-9 [L. pimpinellifolium]	26	407	6e-38
FLS2 [A.thaliana]	27	394	2e-41
CLV2 [A. thaliana]	28	459	1e-29
CLV2 [A. thaliana]	33	483	1e-36
Cf-9 [L. pimpinellifolium]	35	145	9e-13
FLS2 [A.thaliana]	36	967	1e-143
Cf-9 [L. pimpinellifolium]	49	567	7e-53
Cf-9 [L. pimpinellifolium]	99	568	4e-40
CLV2 [A. thaliana]	126	581	2e-42
Rpg1 [Hordeum vulgare]	643	869	5e-26
Pto [L. esculentum]	645	968	5e-30
Rpg1 [Hordeum vulgare]	651	869	7e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	588	610	in -> out

Report for 5531.m00139

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)