Report for 5535.m00162

 > 5535.m00162, length: 600, copies: 1 

MSGRHADGFAGERAFQKLSKLSLSHNSLTNEGVAALVINRTTLSELYLGGNQLLTTSWISNLTSLRVVDLSQNFL

HGYNGICNLHQLEYLHLGVNMLHGTINSCLGKLQQLKYLNMERNFLMGEIAPNLLINLTKLETIHLGVNNLTGTF

MLSWLANSSNLVDVVLSHNYNLKIETELVRWTPLFQLVLDLSENKISMSIPTNFGSIFQFLDYCDMSSNRLYGGI

PSLAEATSLEVLDLSSNNLNEEILPTLIGNLSILTSLLLSNNDLTGPMPPFHWNLGSLKHLSLENNRSSGWLSPL

LSNSSNLKTLNVRNNHLSGIIPDGLLSFQQLGVILLGGNDFHGPIPLDLCFNNYLHFVDLSNNQFSGEIPNCFYN

DFWTDLPMYFNDDPFSGNITERMSVDFTTKGENLTYMGEPLVLMTGIDLSMNQLSGAIPPPLGFLRQLKSLNLSH

NQLVGPIPETFMYMQDMESLDLSYNHLNGSLPMQLANLSFLCSFNVAYNNLSGEIPFQQQLGTFDESAFEGNDNL

CGEIINKNCSSVLHQNQGVFDAIDTSLVFWSYVFGCFALGFWGTVALLIWDEVCRRRLCDLMDALMFKLGWEFVP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	110	134	0.33
LRR [Pfam ls]	233	257	0.071
LRR [Pfam ls]	306	329	0.034
LRR [Pfam ls]	442	465	0.02
LRR [Pfam ls]	466	489	2.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	17	41	1.2
LRR [sensitive, ls]	17	41	24
LRR [sensitive, ls]	42	63	0.52
LRR [sensitive, ls]	42	63	10
LRR [sensitive, ls]	64	85	0.57
LRR [sensitive, ls]	64	85	12
LRR [sensitive, ls]	86	109	0.71
LRR [sensitive, ls]	86	109	14
LRR [sensitive, ls]	110	134	0.016
LRR [sensitive, ls]	110	134	0.33
LRR [sensitive, ls]	135	159	0.78
LRR [sensitive, ls]	135	159	16
LRR [sensitive, ls]	233	257	0.0035
LRR [sensitive, ls]	233	257	0.071
LRR [sensitive, ls]	258	287	1.5
LRR [sensitive, ls]	258	287	30
LRR [sensitive, ls]	306	329	0.0017
LRR [sensitive, ls]	306	329	0.034
LRR [sensitive, ls]	354	378	0.81
LRR [sensitive, ls]	354	378	16
LRR [sensitive, ls]	418	441	7
LRR [sensitive, ls]	418	441	140
LRR [sensitive, ls]	442	465	0.001
LRR [sensitive, ls]	442	465	0.02
LRR [sensitive, ls]	466	489	0.11
LRR [sensitive, ls]	466	489	2.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	534	3e-46
FLS2 [A.thaliana]	17	527	9e-43
Xa21 [O. sativa]	17	529	3e-39
CLV2 [A. thaliana]	34	505	2e-31
Xa21 [O. sativa]	39	370	7e-20
FLS2 [A.thaliana]	43	539	1e-41
FLS2 [A.thaliana]	59	506	4e-35
Cf-9 [L. pimpinellifolium]	60	485	1e-33
CLV2 [A. thaliana]	87	572	9e-42
Cf-9 [L. pimpinellifolium]	110	506	2e-21
CLV2 [A. thaliana]	189	529	1e-29
Xa21 [O. sativa]	216	506	3e-20
FLS2 [A.thaliana]	226	506	6e-31
FLS2 [A.thaliana]	259	506	1e-18
FLS2 [A.thaliana]	263	506	9e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	553	575	out -> in

Report for 5535.m00162

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)