Report for 5588.m00119

 > 5588.m00119, length: 1343, copies: 1 

MATSIMITLLLYLWFLASIAIASIAIASTPDSVTAGNGSDTDVTALLAFKAQLADPRGVLSNWTTATSFCHWFGV

SCSRRRARVVALVLHDVPLQGSISPHLGNLSFLTVLNLTSTGLTGAIPADLGKLHRLEVLVFRRNSLSGVIPPVV

GNLTRLEVVDMGHNSISGQIPLELQKLHNLTHIDFITNYLTGPLPNDLFSNNSKLQYLDFGNNSLTGTLPYSVGS

LGMLQHLDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIPGNNNTFNLPMLQMISLFANRFTGQIPLGLAN

CKYIQIISIGENSFEGPVPTWLSKLPDLLLLDLGYNNLIGQIPSALGNITNLVSLGLQSCTLSGLIPQELGQLQQ

LNALYLDHNHFTGSIPTFFANFSELQVFLIGANSFTGSVPTALGSSRSIEWFNIGGNYQEGSLDFLATLSNCQNI

WEVGFDLNDFTGKLPDYVGNFSSTLINFFAEGNKLSGELPSTLSNLSNLVWLDISNNQLTGTIPESIKLMDKLQL

LNLSGNSLSGSIPRQIGQLWNLQTLILNNNNFSAASRAAVTSQSYAAASWRSHPSRSKAARRRRWPGQAWSQRMR

PTVSPLRRRSLLSQNVGYNSLSGQIPRELQNLRNLRYIDLLVNYLTGPLPNDLFNNTPKLKYLNFRNNSLSGTIP

VGIGTLPILQHLEIAYNHFSGPVPELIFNMSKLEMLHLGGNGYLDGSIPGNKSFNLPMLQKICLYENRFMGQIPL

GLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVGPIPSALGNLSNLDTLGLQSCNLTGQIPQELA

QLRKIKGLFLDHNHFTGSIPTFFANFSELAVFLIGANSFTGAVPTAIGSTGSVEWFNIGDNYLQGSLDFLATLSN

CQNIWEVGFDLNYFTGELPNYVGNFSSTLINFFAVGNRLSGDLPSTLLNLSNLVWLDLSNNQLTGTIPESIMLMD

KLQVLNLSGNIMSGTIPRQIGHLRNLQTLILNNNNFSGVLPNDLGNLSNLQYLVLSKNHMSSTIPASLFHMNSLI

TVDLSQNSLEGALPVDIGQLNHIDRIDLSSNRLFGRIPESFGQFLMTTYLNLSHNSLNGSFPNSFDKLINLKSLD

VSYNDLSGTIPQYLANFTDLSSLNLSFNNLHGPIPEGGIFANITLQSLMGNPALCGGVPRLGFMPCKSNNNSNKR

QILKFLLPSVIIVVGVIATCMYMMMRKKAKQQDRIISPDMEDVLNNRLISYHDIVRATDNFSETKLLGAGSFGKV

FKGQLNDGTMVAIKVLNMELEQAIRSFDSECHALRMARHRNLIRILTTCSNLDFFFSPGRPKEANRVY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	130	1.1
LRR [Pfam ls]	131	154	1.1
LRR [Pfam ls]	155	178	0.44
LRR [Pfam ls]	204	227	0.37
LRR [Pfam ls]	252	274	6.3
LRR [Pfam ls]	327	350	5.9
LRR [Pfam ls]	351	374	3.4
LRR [Pfam ls]	375	398	0.44
LRR [Pfam ls]	498	521	0.025
LRR [Pfam ls]	522	545	0.032
LRR [Pfam ls]	659	682	0.05
LRR [Pfam ls]	781	804	0.089
LRR [Pfam ls]	805	828	0.81
LRR [Pfam ls]	829	852	1.9
LRR [Pfam ls]	952	975	0.027
LRR [Pfam ls]	976	999	0.035
LRR [Pfam ls]	1000	1023	0.032
LRR [Pfam ls]	1024	1047	0.68
LRR [Pfam ls]	1048	1071	3.3
LRR [Pfam ls]	1072	1095	6.7
LRR [Pfam ls]	1096	1119	6.1
LRR [Pfam ls]	1120	1143	0.015
Ser/Thr pkinase [Pfam fs]	1261	1324	5e-12

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	83	106	3.1
LRR [sensitive, ls]	83	106	62
LRR [sensitive, ls]	107	130	0.057
LRR [sensitive, ls]	107	130	1.1
LRR [sensitive, ls]	131	154	0.052
LRR [sensitive, ls]	131	154	1.1
LRR [sensitive, ls]	155	178	0.022
LRR [sensitive, ls]	155	178	0.44
LRR [sensitive, ls]	179	203	0.5
LRR [sensitive, ls]	179	203	10
LRR [sensitive, ls]	204	227	0.018
LRR [sensitive, ls]	204	227	0.37
LRR [sensitive, ls]	228	251	0.97
LRR [sensitive, ls]	228	251	20
LRR [sensitive, ls]	252	274	0.31
LRR [sensitive, ls]	252	274	6.3
LRR [sensitive, ls]	279	302	2.3
LRR [sensitive, ls]	279	302	47
LRR [sensitive, ls]	303	326	1.2
LRR [sensitive, ls]	303	326	25
LRR [sensitive, ls]	327	350	0.29
LRR [sensitive, ls]	327	350	5.9
LRR [sensitive, ls]	351	374	0.17
LRR [sensitive, ls]	351	374	3.4
LRR [sensitive, ls]	375	398	0.022
LRR [sensitive, ls]	375	398	0.44
LRR [sensitive, ls]	474	497	1.4
LRR [sensitive, ls]	474	497	28
LRR [sensitive, ls]	498	521	0.0012
LRR [sensitive, ls]	498	521	0.025
LRR [sensitive, ls]	522	545	0.0016
LRR [sensitive, ls]	522	545	0.032
LRR [sensitive, ls]	546	569	0.74
LRR [sensitive, ls]	546	569	15
LRR [sensitive, ls]	634	658	0.6
LRR [sensitive, ls]	634	658	12
LRR [sensitive, ls]	659	682	0.0025
LRR [sensitive, ls]	659	682	0.05
LRR [sensitive, ls]	683	706	0.49
LRR [sensitive, ls]	683	706	9.9
LRR [sensitive, ls]	707	730	1.7
LRR [sensitive, ls]	707	730	33
LRR [sensitive, ls]	733	756	4
LRR [sensitive, ls]	733	756	80
LRR [sensitive, ls]	757	780	0.63
LRR [sensitive, ls]	757	780	13
LRR [sensitive, ls]	781	804	0.0044
LRR [sensitive, ls]	781	804	0.089
LRR [sensitive, ls]	805	828	0.04
LRR [sensitive, ls]	805	828	0.81
LRR [sensitive, ls]	829	852	0.093
LRR [sensitive, ls]	829	852	1.9
LRR [sensitive, ls]	877	899	1.5
LRR [sensitive, ls]	877	899	30
LRR [sensitive, ls]	928	951	6.9
LRR [sensitive, ls]	928	951	140
LRR [sensitive, ls]	952	975	0.0013
LRR [sensitive, ls]	952	975	0.027
LRR [sensitive, ls]	976	999	0.0018
LRR [sensitive, ls]	976	999	0.035
LRR [sensitive, ls]	1000	1023	0.0016
LRR [sensitive, ls]	1000	1023	0.032
LRR [sensitive, ls]	1024	1047	0.034
LRR [sensitive, ls]	1024	1047	0.68
LRR [sensitive, ls]	1048	1071	0.16
LRR [sensitive, ls]	1048	1071	3.3
LRR [sensitive, ls]	1072	1095	0.33
LRR [sensitive, ls]	1072	1095	6.7
LRR [sensitive, ls]	1096	1119	0.3
LRR [sensitive, ls]	1096	1119	6.1
LRR [sensitive, ls]	1120	1143	0.00073
LRR [sensitive, ls]	1120	1143	0.015
LRR [sensitive, ls]	1144	1169	0.96
LRR [sensitive, ls]	1144	1169	19

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	5	724	2e-76
FLS2 [A.thaliana]	40	822	2e-82
CLV2 [A. thaliana]	42	558	7e-53
Cf-9 [L. pimpinellifolium]	62	845	8e-56
CLV2 [A. thaliana]	71	542	1e-41
FLS2 [A.thaliana]	86	558	4e-63
FLS2 [A.thaliana]	87	562	1e-64
Cf-9 [L. pimpinellifolium]	103	578	8e-40
Cf-9 [L. pimpinellifolium]	108	657	6e-44
Cf-9 [L. pimpinellifolium]	203	993	7e-49
FLS2 [A.thaliana]	458	1321	1e-117
Cf-9 [L. pimpinellifolium]	483	1181	4e-63
Xa21 [O. sativa]	483	1040	5e-61
Cf-9 [L. pimpinellifolium]	515	1184	2e-49
CLV2 [A. thaliana]	596	1184	1e-56
FLS2 [A.thaliana]	621	1185	6e-65
FLS2 [A.thaliana]	638	1160	1e-65
Xa21 [O. sativa]	663	1328	1e-115
FLS2 [A.thaliana]	737	1185	6e-62
CLV2 [A. thaliana]	756	1164	6e-44
FLS2 [A.thaliana]	776	1184	3e-55
Xa21 [O. sativa]	782	1160	7e-54
CLV2 [A. thaliana]	785	1197	2e-37
CLV2 [A. thaliana]	808	1183	1e-35
CLV2 [A. thaliana]	924	1160	2e-21
CLV2 [A. thaliana]	948	1160	1e-21
Xa21 [O. sativa]	997	1168	5e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	1205	1224	out -> in

Report for 5588.m00119

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)