Report for 5605.m00195

 > 5605.m00195, length: 756, copies: 1 

MRSAYHLMPPLAMLLIHGLADHASSTEAPAACLPDQASALLQLKRSFNATIGDYPAAFRSWVAGADCCHWDGVRC

GGAGGRVTSLDLSHRDLQASSGLDDALFSLTSLEYLDLSSNDFSKSKLPATGFEMLTGLTHLDLSNTNFAGLVPA

GIGRLTSLNYLDLSTTFFVEELDDEYSITYYYSDTMAQLSEPSLETLLANLTNLEEFAWACLSVLQLSNNMFEGV

FPPIIFQHEKLTTINLTKNLGISGNLPTSFSGDSSLQSLSVSNTNFSGTIPGSISNLRSLKELALGASGFSGVLP

SSIGQLKSLSLLEVSGLELVGSIPSWISNLTSLTVLKFFSCGLSGPITTPDQVISDGPKPSPLTGLVLHLHEITF

LDLSYNQIQGAIPLWAWKTLNLGFALFNLSHNKFTSIGSDHPLLPVYIEFFDLSFNNIEGVIPIPKEGSVTLDYS

NNRFSSLPLNFSTYLSNTVLFKASNNSISGNIPPSICDRIKSLQLIDLSNNNLTGLIPSCLMEDADALQVLSLKD

NHLTGELPDNIKEGCALSALDFSGNSIQGQLPRSLVACRNLEILDIGNNKISDSFPCWMSKLPQLQVLVLKSNKF

IGQILDPSYTGGGNNCQFTKLQFADMSSNNLSGTLPEEWFKMLKSMIMDTCDNDMLMREQHLYYRGKMQSYQFTA

GISYKGSGLTISKTLRTLVLIDVSNNAFHGRIPRSIGELVLLRALNMSHNALTGPIPVQFANLKQLELLDLSSNE

LSGEIL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	132	0.061
LRR [Pfam ls]	133	156	0.39
LRR [Pfam ls]	260	283	0.1
LRR [Pfam ls]	308	331	4.9
LRR [Pfam ls]	372	396	0.19
LRR [Pfam ls]	492	513	0.099
LRR [Pfam ls]	517	537	5.3
LRR [Pfam ls]	565	588	0.12
LRR [Pfam ls]	620	644	0.49
LRR [Pfam ls]	716	739	0.35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	106	0.48
LRR [sensitive, ls]	81	106	11
LRR [sensitive, ls]	107	132	0.0027
LRR [sensitive, ls]	107	132	0.061
LRR [sensitive, ls]	133	156	0.017
LRR [sensitive, ls]	133	156	0.39
LRR [sensitive, ls]	211	234	0.55
LRR [sensitive, ls]	211	234	12
LRR [sensitive, ls]	235	259	0.72
LRR [sensitive, ls]	235	259	16
LRR [sensitive, ls]	260	283	0.0047
LRR [sensitive, ls]	260	283	0.1
LRR [sensitive, ls]	284	307	1
LRR [sensitive, ls]	284	307	22
LRR [sensitive, ls]	308	331	0.22
LRR [sensitive, ls]	308	331	4.9
LRR [sensitive, ls]	332	358	4.2
LRR [sensitive, ls]	332	358	95
LRR [sensitive, ls]	372	396	0.0087
LRR [sensitive, ls]	372	396	0.19
LRR [sensitive, ls]	398	417	2
LRR [sensitive, ls]	398	417	45
LRR [sensitive, ls]	422	443	1.9
LRR [sensitive, ls]	422	443	42
LRR [sensitive, ls]	467	491	1.6
LRR [sensitive, ls]	467	491	35
LRR [sensitive, ls]	492	513	0.0044
LRR [sensitive, ls]	492	513	0.099
LRR [sensitive, ls]	517	537	0.24
LRR [sensitive, ls]	517	537	5.3
LRR [sensitive, ls]	541	564	0.52
LRR [sensitive, ls]	541	564	12
LRR [sensitive, ls]	565	588	0.0052
LRR [sensitive, ls]	565	588	0.12
LRR [sensitive, ls]	620	644	0.022
LRR [sensitive, ls]	620	644	0.49
LRR [sensitive, ls]	692	715	0.38
LRR [sensitive, ls]	692	715	8.5
LRR [sensitive, ls]	716	739	0.015
LRR [sensitive, ls]	716	739	0.35

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	13	755	3e-94
Xa21 [O. sativa]	39	604	6e-35
FLS2 [A.thaliana]	41	755	5e-52
CLV2 [A. thaliana]	76	488	6e-20
FLS2 [A.thaliana]	80	604	8e-41
FLS2 [A.thaliana]	81	755	1e-48
Xa21 [O. sativa]	81	581	4e-36
Cf-9 [L. pimpinellifolium]	82	604	2e-26
Cf-9 [L. pimpinellifolium]	82	324	4e-13
Cf-9 [L. pimpinellifolium]	95	581	2e-26
FLS2 [A.thaliana]	98	322	2e-17
Xa21 [O. sativa]	183	755	7e-46
CLV2 [A. thaliana]	235	756	8e-49
Xa21 [O. sativa]	255	741	3e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5605.m00195

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)