Report for 5605.m00196

 > 5605.m00196, length: 993, copies: 2 

MYILLQVQATTNTARTVVPPVRCHPDQASALLRLKHSFNATAGDYSTAFQSWVAGTDCCRWDGVGCGGADGRVTS

LDLGGHQLQAGSVDPALFRLTSLKHLNLSGNDFSMSQLPVITGFEQLTELVYLDLSDTNIAGEVPGSIGRLTNLV

YLDLSTSFYIVEYNDDEQVTFDSDSVWQLSAPNMETLIENHSNLEELHMGMVDLSGNGERWCDNIAKYTPKLQVL

SLPYCSLSGPICASFSALQALTMIELHYNHLSGSVPEFLAGFSNLTVLQLSKNKFQGSFPPIIFQHKKLRTINLS

KNPGISGNLPNFSQDTSLENLFLNNTNFTGTIPGSIINLISVKKLDLGASGFSGSLPSSLGSLKYLDMLQLSGLQ

LVGTIPSWISNLTSLTVLRISNCGLSGPVPSSIGNLRELTTLALYNCNFSGTVHPQILNLTRLQTLLLHSNNFAG

TVDLTSFSKLKNLTFLNLSNNKLLVVEGKNSSSLVLFPKLQLLSLASCSMTTFPNILRDLPDITSLDLSNNQIQG

AIPQWAWKTWKGLQFIVLNISHNNFTSLGSDPFLPLYVEYFDLSFNSIEGPIPIPQEGSSTLDYSSNQFSSMPLR

YSTYLGETVTFKASKNKLSGNVPPLICTTARKLQLIDLSYNNLSGSIPSCLLESFSELQVLSLKANKFVGKLPDI

IKEGCALEALDLSDNSIEGKIPRSLVSCRNLEILDIGSNQISDSFPCWLSQLPKLQVLVLKSNKLTGQVMDPSYT

GRQISCEFPALRIADMASNNLNGMLMEGWFKMLKSMMARSDNDTLVMENQYYHGQTYQFTATVTYKGNDRTISKI

LRSLVLIDVSGNAFHGAIPDTIGELVLLRGLNLSHNALTGPIPSQFCRLDQLESLDLSFNELSGEIPKELASLNF

LSTLNLSNNTLVGRIPDSYQFSTFSNSSFLGNTGLCGLPLSRQCDNPEEPSAIPYTSEKSIDAVLLLFTALGFGI

SFAMTILIVWGSHMRKRH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	0.43
LRR [Pfam ls]	124	147	1
LRR [Pfam ls]	221	244	1.6
LRR [Pfam ls]	245	268	3.4
LRR [Pfam ls]	269	292	0.61
LRR [Pfam ls]	293	316	2.6
LRR [Pfam ls]	317	340	5.5
LRR [Pfam ls]	389	412	0.015
LRR [Pfam ls]	413	436	4
LRR [Pfam ls]	437	461	1.1
LRR [Pfam ls]	462	485	4.1
LRR [Pfam ls]	489	511	0.41
LRR [Pfam ls]	512	536	0.099
LRR [Pfam ls]	539	562	3
LRR [Pfam ls]	632	656	0.0022
LRR [Pfam ls]	681	704	0.7
LRR [Pfam ls]	705	728	0.087
LRR [Pfam ls]	828	851	4.8
LRR [Pfam ls]	852	875	1
LRR [Pfam ls]	876	899	0.0048

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	72	96	1.1
LRR [sensitive, ls]	72	96	25
LRR [sensitive, ls]	97	120	0.019
LRR [sensitive, ls]	97	120	0.43
LRR [sensitive, ls]	124	147	0.046
LRR [sensitive, ls]	124	147	1
LRR [sensitive, ls]	148	180	3.2
LRR [sensitive, ls]	148	180	71
LRR [sensitive, ls]	221	244	0.07
LRR [sensitive, ls]	221	244	1.6
LRR [sensitive, ls]	245	268	0.15
LRR [sensitive, ls]	245	268	3.4
LRR [sensitive, ls]	269	292	0.027
LRR [sensitive, ls]	269	292	0.61
LRR [sensitive, ls]	293	316	0.11
LRR [sensitive, ls]	293	316	2.6
LRR [sensitive, ls]	317	340	0.24
LRR [sensitive, ls]	317	340	5.5
LRR [sensitive, ls]	341	364	0.34
LRR [sensitive, ls]	341	364	7.6
LRR [sensitive, ls]	365	388	0.37
LRR [sensitive, ls]	365	388	8.3
LRR [sensitive, ls]	389	412	0.00068
LRR [sensitive, ls]	389	412	0.015
LRR [sensitive, ls]	413	436	0.18
LRR [sensitive, ls]	413	436	4
LRR [sensitive, ls]	437	461	0.05
LRR [sensitive, ls]	437	461	1.1
LRR [sensitive, ls]	462	485	0.18
LRR [sensitive, ls]	462	485	4.1
LRR [sensitive, ls]	489	511	0.018
LRR [sensitive, ls]	489	511	0.41
LRR [sensitive, ls]	512	536	0.0044
LRR [sensitive, ls]	512	536	0.099
LRR [sensitive, ls]	539	562	0.13
LRR [sensitive, ls]	539	562	3
LRR [sensitive, ls]	632	656	9.7e-05
LRR [sensitive, ls]	632	656	0.0022
LRR [sensitive, ls]	681	704	0.031
LRR [sensitive, ls]	681	704	0.7
LRR [sensitive, ls]	705	728	0.0039
LRR [sensitive, ls]	705	728	0.087
LRR [sensitive, ls]	729	762	1.6
LRR [sensitive, ls]	729	762	37
LRR [sensitive, ls]	828	851	0.21
LRR [sensitive, ls]	828	851	4.8
LRR [sensitive, ls]	852	875	0.045
LRR [sensitive, ls]	852	875	1
LRR [sensitive, ls]	876	899	0.00022
LRR [sensitive, ls]	876	899	0.0048
LRR [sensitive, ls]	900	922	0.38
LRR [sensitive, ls]	900	922	8.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	20	987	1e-102
CLV2 [A. thaliana]	26	696	2e-46
Xa21 [O. sativa]	30	578	1e-38
FLS2 [A.thaliana]	68	623	1e-41
CLV2 [A. thaliana]	86	553	1e-22
Xa21 [O. sativa]	91	407	2e-17
Xa21 [O. sativa]	91	382	5e-15
Xa21 [O. sativa]	205	744	2e-42
FLS2 [A.thaliana]	222	984	2e-70
Xa21 [O. sativa]	293	775	5e-36
CLV2 [A. thaliana]	320	987	6e-54
FLS2 [A.thaliana]	330	916	5e-45
Xa21 [O. sativa]	342	937	3e-46
CLV2 [A. thaliana]	352	923	4e-32
FLS2 [A.thaliana]	375	941	5e-43
Xa21 [O. sativa]	393	937	2e-35
Xa21 [O. sativa]	610	958	2e-25
Xa21 [O. sativa]	784	918	2e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	963	985	out -> in

Report for 5605.m00196

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)