Report for 5615.m00073

 > 5615.m00073, length: 532, copies: 1 

MTTLPTAILLLLLLLALPPPSAVVALTADGLALLALKAAVTDDPLSVLSSWSESDPDPCRWPGVTCSNVTAAGGE

PRRRVVGVALAGKNLSGYIPSELGSLLFLRRLNLHDNRLAGGVPAALSNASSLHSLFLYGNRLTGALPAALCDIP

RLQNLDVSRNALSGGLPGDLRNCRSLQRLILAGNSFSGEVPAGIWAEMASLQQLDISSNGFNGSIPADLGELPRL

AGTLNLSHNRFSGVVPPELGRLPATVTLDLRFNNLSGAIPQTGSLASQGPTSFLNNPGLCGFPLQVPCRAVPPPT

QSPPAPTTTTTTTTPSSASAAAAAASEHHQPIRTSLIALISIADAAGVALVGVILVYVYWKVKDRKKQGRSSTVA

AGDENESRHGLCRCIWGHRGVDSDTDTDDSSASENGGGGGKYGEGELVAIDRGFRVELDELLRSSAYVLGKGGKG

IVYKVVVGNGATPVAVRRLGGGGGGGERCKEFAAEARAVGRARHPNVVRLRAYYWSADEKLVVTDFVGNGNLAAA

MRGKHSL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.5
LRR [Pfam ls]	127	150	0.23
LRR [Pfam ls]	151	174	0.043
LRR [Pfam ls]	175	199	1.5
LRR [Pfam ls]	200	223	0.029
Ser/Thr pkinase [Pfam fs]	443	529	7.8e-06

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.022
LRR [sensitive, ls]	103	126	0.5
LRR [sensitive, ls]	127	150	0.01
LRR [sensitive, ls]	127	150	0.23
LRR [sensitive, ls]	151	174	0.0019
LRR [sensitive, ls]	151	174	0.043
LRR [sensitive, ls]	175	199	0.066
LRR [sensitive, ls]	175	199	1.5
LRR [sensitive, ls]	200	223	0.0013
LRR [sensitive, ls]	200	223	0.029
LRR [sensitive, ls]	225	248	0.45
LRR [sensitive, ls]	225	248	10
LRR [sensitive, ls]	249	271	0.78
LRR [sensitive, ls]	249	271	17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	272	1e-28
CLV2 [A. thaliana]	29	270	1e-18
FLS2 [A.thaliana]	32	265	3e-28
Xa21 [O. sativa]	45	267	7e-25
CLV2 [A. thaliana]	67	281	3e-18
FLS2 [A.thaliana]	74	265	3e-17
FLS2 [A.thaliana]	78	266	1e-22
CLV2 [A. thaliana]	79	265	3e-18
CLV2 [A. thaliana]	79	285	2e-13
FLS2 [A.thaliana]	80	265	1e-17
Cf-9 [L. pimpinellifolium]	83	293	8e-16
CLV2 [A. thaliana]	83	218	1e-11
FLS2 [A.thaliana]	83	528	5e-33
FLS2 [A.thaliana]	83	266	4e-21
Xa21 [O. sativa]	83	269	1e-17
Xa21 [O. sativa]	83	218	7e-12
Cf-9 [L. pimpinellifolium]	85	265	4e-13
CLV2 [A. thaliana]	85	280	7e-13
FLS2 [A.thaliana]	85	267	2e-22
FLS2 [A.thaliana]	85	265	4e-19
FLS2 [A.thaliana]	86	265	1e-19
Cf-9 [L. pimpinellifolium]	89	267	4e-13
FLS2 [A.thaliana]	89	267	7e-26
FLS2 [A.thaliana]	89	267	4e-23
Xa21 [O. sativa]	89	201	4e-13
FLS2 [A.thaliana]	90	266	4e-23
FLS2 [A.thaliana]	90	266	2e-20
Xa21 [O. sativa]	92	241	4e-17
Cf-9 [L. pimpinellifolium]	104	267	2e-16
Cf-9 [L. pimpinellifolium]	104	266	3e-14
Cf-9 [L. pimpinellifolium]	104	284	3e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	338	360	out -> in

Report for 5615.m00073

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)