Report for 5644.m00199

 > 5644.m00199, length: 964, copies: 2 

MLPQQLQIYLCFILLSLKFGISASLPLETDALLDIKSHLEDPQNYLGNWDESHSPCQFYGVTCDQTSGGVIGISL

SNASLSGTISSSFSLLSQLRTLELGANSISGTIPAALANCTNLQVLNLSTNSLTGQLPDLSTFINLQVLDLSTNN

FSGPFPAWVGKLSGLTELGLGENNFNEGDVPESIGKLKNLTWLFLGQCNLRGELPVSIFDLVSLGTLDFSRNQII

GVFPIAISNLRNLWKIELYQNNLTGEIPPELAHLTLLSEFDVSQNQLSGILPKEIANLKKLKIFHIYRNNFSGVL

PEGLGDLEFLESFSTYENQFSGKFPANLGRFSPLNAIDISENYFSGEFPRFLCQNNKLQFLLALDNNFSGEFPSS

YSSCKTLQRFRISQNQFTGRIHSGIWGLPNAVIIDVANNKFVGGISSDIGISASLNQLYVHNNVFSGELPMELGK

LSLLQKLVAFNNRFSGQIPAQIGSLKQLSFLHLEQNALEGSIPPDIGMCNSLVDLNLADNSLTGTIPDTLASLFT

LNSLNLSHNMISGEIPEGLQYLKLSYVDFSHNNLSGPVPPALLMIAGDDAFSENDGLCIAGVSEGWRQNATNLRY

CPWNDNHQNFSQRRLFVVLIIVTSLVVLLSGLACLRYENYKLEQFHSKGDIESGDDSDSKWVLESFHPPELDPEE

ICNLDVDNLIGCGGTGKVYRLELSKGRGVVAVKQLWKRDDAKVMRTEINTLGKIRHRNILKLHAFLTGGESNFLV

YEYVVNGNLYDAIRREFKAGQPELDWEKRYRIAVGTAKGIMYLHHDCSPAIIHRDIKSTNILLDEEYEAKLADFG

IAKLVEGSPLSCFAGTHGYMAPELAYSLKVTEKSDVYSFGIVLLELLTGRSPSDQQFDGELDIVSWVSSHLANQN

PAAVLDPKVSSHASEDMTKVLNIAILCTVQLPSERPTMREVVKMLIDIDSISANGKAKNKNDKK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	0.1
LRR [Pfam ls]	117	139	0.41
LRR [Pfam ls]	140	163	0.36
LRR [Pfam ls]	164	188	8.8
LRR [Pfam ls]	189	212	6.9
LRR [Pfam ls]	237	260	0.017
LRR [Pfam ls]	285	308	6.9
LRR [Pfam ls]	381	404	9.7
LRR [Pfam ls]	429	452	9.6
LRR [Pfam ls]	477	500	7.1
LRR [Pfam ls]	501	524	0.44
LRR [Pfam ls]	525	545	0.16
Ser/Thr pkinase [Pfam fs]	679	945	2.5e-50
Ser/Thr pkinase [Pfam ls]	679	945	4.4e-50

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	92	3.2
LRR [sensitive, ls]	69	92	63
LRR [sensitive, ls]	93	116	0.0051
LRR [sensitive, ls]	93	116	0.1
LRR [sensitive, ls]	117	139	0.021
LRR [sensitive, ls]	117	139	0.41
LRR [sensitive, ls]	140	163	0.018
LRR [sensitive, ls]	140	163	0.36
LRR [sensitive, ls]	164	188	0.45
LRR [sensitive, ls]	164	188	8.8
LRR [sensitive, ls]	189	212	0.35
LRR [sensitive, ls]	189	212	6.9
LRR [sensitive, ls]	213	236	0.54
LRR [sensitive, ls]	213	236	11
LRR [sensitive, ls]	237	260	0.00085
LRR [sensitive, ls]	237	260	0.017
LRR [sensitive, ls]	261	284	0.57
LRR [sensitive, ls]	261	284	11
LRR [sensitive, ls]	285	308	0.35
LRR [sensitive, ls]	285	308	6.9
LRR [sensitive, ls]	333	357	6.4
LRR [sensitive, ls]	333	357	130
LRR [sensitive, ls]	381	404	0.49
LRR [sensitive, ls]	381	404	9.7
LRR [sensitive, ls]	429	452	0.49
LRR [sensitive, ls]	429	452	9.6
LRR [sensitive, ls]	453	476	1.8
LRR [sensitive, ls]	453	476	35
LRR [sensitive, ls]	477	500	0.36
LRR [sensitive, ls]	477	500	7.1
LRR [sensitive, ls]	501	524	0.023
LRR [sensitive, ls]	501	524	0.44
LRR [sensitive, ls]	525	545	0.008
LRR [sensitive, ls]	525	545	0.16
LRR [sensitive, ls]	548	569	0.72
LRR [sensitive, ls]	548	569	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	12	570	3e-56
FLS2 [A.thaliana]	12	582	5e-80
Cf-9 [L. pimpinellifolium]	26	564	2e-46
Xa21 [O. sativa]	31	766	4e-82
Cf-9 [L. pimpinellifolium]	58	373	5e-22
Cf-9 [L. pimpinellifolium]	66	582	4e-48
FLS2 [A.thaliana]	70	964	1e-114
Cf-9 [L. pimpinellifolium]	73	442	4e-26
CLV2 [A. thaliana]	73	542	3e-43
Pto [L. esculentum]	657	942	1e-34
Rpg1 [Hordeum vulgare]	678	954	4e-20
Rpg1 [Hordeum vulgare]	683	948	1e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	615	637	out -> in

Report for 5644.m00199

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)