Report for 5718.m00169

 > 5718.m00169, length: 1015, copies: 1 

MSSFSKRVPHHVASLLAMMLILQLVQATTLDDLTTTSSETTPAMCLPDQASALLRLKHSFNATAGDYSTTFRSWV

PGADCCRWEGVHCDGADGRVTSLDLGGHNLQAGGLDHALFRLTSLKHLNLSGNIFTMSQLPATGFEQLTELTHLD

LSDTNIAGKVPAGIGRLVSLVYLDLSTSFVIVSYDDENSITQYAVDSIGQLSAPNMETLLTNLTNLEELHMGMVD

MSNNGELWCDHIAKYTPKLQVLSLPYCSLSGPVCASFAAMRSLTTIELHYNLLSGSVPEFLAGFSNLTVLQLSTN

KFQGWFPPIIFQHKKLRTIDLSKNPGISGNLPNFSQDSSLENLSVSRTNFTGMIPSSISNLRSLKKLGIGASGFS

GTLPSSLGSFLYLDLLEVSGFQIVGSMPSWISNLTSLTVLQFSNCGLSGHVPSSIGNLRELIKLALYNCKFSGKV

PPQILNLTHLETLVLHSNNFDGTIELTSFSKLKNLSVLNLSNNKLVVVDGENISSLVSFPNLEFLSLASCSMSTF

PNILKHLDKMFSLDISHNQIQGAIPQWAWKTWKGLQFLLLNMSHNNFTSLGSDPLLPLHIEFLDLSFNSIEGPIP

IPQEGSSTLDYSSNQFSSIPLHYLTYLGETLTFKASRNKLSGDIPPSICTAATNLQLFDLSYNNLSGSIPSCLME

DAIELQVLSLKENKLVGNLPDSIKEGCSLEAIDLSGNLIDGKIPRSLVSCRNLEILDVGNNQISDSFPCWMSKLR

KLQVLVLKSNKFTGQVMDPSYTVDRNSCAFTQLRIADMASNNFNGTLPEAWFKMLKSMIAMTQNDTLVMENKYYH

GQTYQFTASVTYKGSDTTISKILRTLMLIDFSNNAFHGTIPETVGGLVLLHGLNMSHNALTGSIPTQFGRLNQLE

SLDLSSNELTGGIPKELASLNFLSTLNLSYNMLVGRIPNSYQFSTFSNNSFLGNIGLCGPPLSKQCDNPKEPIVM

TYTSEKSTDVVLVLFTALGFGVSYAMTILILWGRCMRKQR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	144	0.023
LRR [Pfam ls]	145	168	1.1
LRR [Pfam ls]	243	266	5.1
LRR [Pfam ls]	267	290	0.37
LRR [Pfam ls]	315	338	2.9
LRR [Pfam ls]	339	362	0.24
LRR [Pfam ls]	411	434	0.091
LRR [Pfam ls]	459	483	0.21
LRR [Pfam ls]	484	507	0.18
LRR [Pfam ls]	511	533	1.7
LRR [Pfam ls]	534	558	3.4
LRR [Pfam ls]	654	674	0.57
LRR [Pfam ls]	703	726	2.5
LRR [Pfam ls]	727	750	0.52
LRR [Pfam ls]	874	897	1.5
LRR [Pfam ls]	898	921	0.0025

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	118	1.2
LRR [sensitive, ls]	94	118	26
LRR [sensitive, ls]	119	144	0.001
LRR [sensitive, ls]	119	144	0.023
LRR [sensitive, ls]	145	168	0.051
LRR [sensitive, ls]	145	168	1.1
LRR [sensitive, ls]	243	266	0.23
LRR [sensitive, ls]	243	266	5.1
LRR [sensitive, ls]	267	290	0.017
LRR [sensitive, ls]	267	290	0.37
LRR [sensitive, ls]	291	314	2.3
LRR [sensitive, ls]	291	314	51
LRR [sensitive, ls]	315	338	0.13
LRR [sensitive, ls]	315	338	2.9
LRR [sensitive, ls]	339	362	0.011
LRR [sensitive, ls]	339	362	0.24
LRR [sensitive, ls]	363	386	2.8
LRR [sensitive, ls]	363	386	62
LRR [sensitive, ls]	411	434	0.0041
LRR [sensitive, ls]	411	434	0.091
LRR [sensitive, ls]	435	458	0.34
LRR [sensitive, ls]	435	458	7.5
LRR [sensitive, ls]	459	483	0.0093
LRR [sensitive, ls]	459	483	0.21
LRR [sensitive, ls]	484	507	0.0078
LRR [sensitive, ls]	484	507	0.18
LRR [sensitive, ls]	511	533	0.074
LRR [sensitive, ls]	511	533	1.7
LRR [sensitive, ls]	534	558	0.15
LRR [sensitive, ls]	534	558	3.4
LRR [sensitive, ls]	561	581	0.64
LRR [sensitive, ls]	561	581	14
LRR [sensitive, ls]	584	606	0.44
LRR [sensitive, ls]	584	606	9.8
LRR [sensitive, ls]	654	674	0.025
LRR [sensitive, ls]	654	674	0.57
LRR [sensitive, ls]	679	699	1.1
LRR [sensitive, ls]	679	699	24
LRR [sensitive, ls]	703	726	0.11
LRR [sensitive, ls]	703	726	2.5
LRR [sensitive, ls]	727	750	0.023
LRR [sensitive, ls]	727	750	0.52
LRR [sensitive, ls]	782	806	0.88
LRR [sensitive, ls]	782	806	20
LRR [sensitive, ls]	850	873	0.66
LRR [sensitive, ls]	850	873	15
LRR [sensitive, ls]	874	897	0.067
LRR [sensitive, ls]	874	897	1.5
LRR [sensitive, ls]	898	921	0.00011
LRR [sensitive, ls]	898	921	0.0025
LRR [sensitive, ls]	922	944	0.53
LRR [sensitive, ls]	922	944	12

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	38	1007	1e-106
CLV2 [A. thaliana]	48	718	9e-45
FLS2 [A.thaliana]	81	800	5e-64
FLS2 [A.thaliana]	104	712	9e-45
Xa21 [O. sativa]	104	600	3e-36
Xa21 [O. sativa]	120	757	3e-46
FLS2 [A.thaliana]	233	1014	1e-66
Xa21 [O. sativa]	247	766	5e-42
CLV2 [A. thaliana]	342	967	1e-55
Xa21 [O. sativa]	366	959	9e-47
CLV2 [A. thaliana]	435	961	4e-29
Xa21 [O. sativa]	436	959	2e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	985	1007	out -> in

Report for 5718.m00169

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)