Report for 5718.m00175

 > 5718.m00175, length: 748, copies: 1 

MSSFSKRVAHHLTSLLTVMHILLQVQATPTLADRTTTSIVTTPVLCLPEQASALLQLKGSFNVTAGDYSTVFRSW

VAGADCCHWEGVHCDGADGRVTSLDLGGHHLQADSVHPALFRLTSLKHLDLSGNNFSMSKLPFTGFQELTELMHL

DLSNTNIAGEVPAGIGSIMNLVYLDLSTKFYALVYDDENNIMKFTLDSFWQLKAPNMETFLTNLTNLEQLHMGMM

DMSREGERWCDHIAKSTPKLQVLSLPWCSLSGPICASLSAMQSLNTIELHRNHLSGSIPEFFASFSNLSVLQLSK

NDFQGWFPPIIFQHKKLRMIDLSKNPGISGNLPNFSQESSLENLFVSSTNFTGSLKYLDLLEVSGLQLVGSIPSW

ISNLTSLTALQFSNCGLSGQVPSSIGNLRKLTKLALYNCNFSGKENKLIGTLPDNIKEGCALEAIDISGNLFEGK

IPRSLIACRNLEILDIGGNHFSDSFPCWMSQLPKLQVLVLKSNKFTGQLMDPSYMVGGNTCEFTELRIADMASND

FNGTLPEAWFKMLKSMMTRSDNETLVMENQYYHGQTYQFTATVTYKGNYMTISKILRTLVLIDFSNNAFHGAIPE

TIGELILLHGLNMSHNALTGSIPTQFGRLNQLESLDLSSNEFSGEIPEELASLNFLSTLNLSYNMLVGRIPNSYQ

FSTFSNNSFLGNTGLCGPPLSRQCNNPKEPIAMPYTLEKSIDVVLLLFTASGFFISFAMMILIVWGSQMRKQH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	145	0.0037
LRR [Pfam ls]	268	291	0.21
LRR [Pfam ls]	381	404	0.86
LRR [Pfam ls]	405	428	3.2
LRR [Pfam ls]	460	483	0.67
LRR [Pfam ls]	607	630	1.5
LRR [Pfam ls]	631	654	0.0056

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	119	1.3
LRR [sensitive, ls]	95	119	30
LRR [sensitive, ls]	120	145	0.00016
LRR [sensitive, ls]	120	145	0.0037
LRR [sensitive, ls]	146	170	0.73
LRR [sensitive, ls]	146	170	16
LRR [sensitive, ls]	244	267	0.52
LRR [sensitive, ls]	244	267	12
LRR [sensitive, ls]	268	291	0.0095
LRR [sensitive, ls]	268	291	0.21
LRR [sensitive, ls]	292	315	3.2
LRR [sensitive, ls]	292	315	73
LRR [sensitive, ls]	316	339	0.28
LRR [sensitive, ls]	316	339	6.4
LRR [sensitive, ls]	357	380	0.47
LRR [sensitive, ls]	357	380	11
LRR [sensitive, ls]	381	404	0.038
LRR [sensitive, ls]	381	404	0.86
LRR [sensitive, ls]	405	428	0.14
LRR [sensitive, ls]	405	428	3.2
LRR [sensitive, ls]	436	459	0.45
LRR [sensitive, ls]	436	459	10
LRR [sensitive, ls]	460	483	0.03
LRR [sensitive, ls]	460	483	0.67
LRR [sensitive, ls]	484	506	2
LRR [sensitive, ls]	484	506	44
LRR [sensitive, ls]	515	539	1.8
LRR [sensitive, ls]	515	539	41
LRR [sensitive, ls]	583	606	0.53
LRR [sensitive, ls]	583	606	12
LRR [sensitive, ls]	607	630	0.067
LRR [sensitive, ls]	607	630	1.5
LRR [sensitive, ls]	631	654	0.00025
LRR [sensitive, ls]	631	654	0.0056
LRR [sensitive, ls]	655	677	0.53
LRR [sensitive, ls]	655	677	12

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	43	672	1e-52
CLV2 [A. thaliana]	48	748	1e-58
Xa21 [O. sativa]	53	735	1e-42
FLS2 [A.thaliana]	57	687	3e-47
Cf-9 [L. pimpinellifolium]	96	714	3e-78
FLS2 [A.thaliana]	103	739	2e-55
CLV2 [A. thaliana]	191	690	1e-32
FLS2 [A.thaliana]	234	704	3e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	718	740	out -> in

Report for 5718.m00175

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)