Report for 5731.m00074

 > 5731.m00074, length: 1274, copies: 1 

MARRRFFPAWVVVVMVVVVVLGSCSAAAAAGDGDALMDVKNAFVEDPGGVLAGWGGGGGNSSAFCSWAGVECDAA

GARVTGLNLSGAGLAGEVPGAALARLDRLEVVDLSSNRLAGPVPAALGALGRLTALLLYSNRLAGELPPSLGALA

ALRVLRVGDNPALSGPIPAALGVLANLTVLAAASCNLTGAIPRSLGRLAALTALNLQENSLSGPIPPELGGIAGL

EVLSLADNQLTGVIPPELGRLAALQKLNLANNTLEGAVPPELGKLGELAYLNLMNNRLSGRVPRELAALSRARTI

DLSGNLLTGELPAEVGQLPELSFLALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTNNFSGEIPGGLSRCRA

LTQLDLANNSLTGVIPAALGELGNLTDLLLNNNTLSGELPPELFNLTELKVLALYHNGLTGRLPDAVGRLVNLEV

LFLYENDFSGEIPETIGECSSLQMVDFFGNRFNGSLPASIGKLSELAFLHLRQNELSGRIPPELGDCVNLAVLDL

ADNALSGEIPATFGRLRSLEQLMLYNNSLAGDVPDGMFECRNITRVNIAHNRLAGGLLPLCGSARLLSFDATNNS

FSGGIPAQLGRSRSLQRVRFGSNALSGPIPAALGNAAALTMLDASGNALTGGIPDALARCARLSHIALSGNRLSG

PVPAWVGALPELGELALSGNELTGPVPVQLSNCSKLIKLSLDGNQINGTVPSEIGSLVSLNVLNLAGNQLSGEIP

ATLAKLINLYELNLSRNLLSGPIPPDIGQLQELQSLLDLSSNDLSGSIPASLGSLSKLESLNLSHNALAGAVPPQ

LAGMSSLVQLDLSSNQLQGRLGSEFSRWPRGAFAGNARLCGHPLVSCGVGGGGRSALRSATIALVSAAVTLSVVL

LVIVLVLIAVRRRRSGEVNCTAFSSSLGGGGNNTNGRQLVVKGSARREFRWEAIMEATANLSDQFAIGSGGSGTV

YRAELPTGETVAVKRIAHMDSDMLLHDKSFAREVKILGRVRHRHLVKLLGFVASHDVGGGGGGGGSMLVYEYMEN

GSLYDWLHGIAAGGGGGGDGERKKRVLSWDARLKVAAGLAQGVEYLHHDCVPRVVHRDIKSSNVLLDGDMEAHLG

DFGLAKSVADNRKDFTDSASCFAGSYGYMAPECGYSLKTTEKSDVYSMGIVMMELVTGLTPTDKAFGGDVDMVRW

VQSRVEAPSPGREQVFDPALKPLAPREESSMTEVLEVALRCTRTAPGERPTARQVSDLLLHVSLDYYRAGEHKR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.77
LRR [Pfam ls]	127	150	3.7
LRR [Pfam ls]	224	247	0.077
LRR [Pfam ls]	248	271	0.42
LRR [Pfam ls]	272	295	5.5
LRR [Pfam ls]	296	319	0.47
LRR [Pfam ls]	320	344	5.9
LRR [Pfam ls]	351	374	0.72
LRR [Pfam ls]	375	398	0.06
LRR [Pfam ls]	399	422	0.13
LRR [Pfam ls]	423	446	2.4
LRR [Pfam ls]	447	470	0.36
LRR [Pfam ls]	495	518	2.6
LRR [Pfam ls]	519	542	0.034
LRR [Pfam ls]	543	566	6
LRR [Pfam ls]	638	661	3.1
LRR [Pfam ls]	662	685	5
LRR [Pfam ls]	710	733	1.9
LRR [Pfam ls]	734	757	0.23
LRR [Pfam ls]	758	781	0.06
LRR [Pfam ls]	807	830	0.042
LRR [Pfam ls]	831	854	0.089
Ser/Thr pkinase [Pfam ls]	961	1260	2.5e-53
Ser/Thr pkinase [Pfam fs]	967	1260	5.5e-53

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	102	1.4
LRR [sensitive, ls]	78	102	29
LRR [sensitive, ls]	103	126	0.037
LRR [sensitive, ls]	103	126	0.77
LRR [sensitive, ls]	127	150	0.18
LRR [sensitive, ls]	127	150	3.7
LRR [sensitive, ls]	151	175	0.35
LRR [sensitive, ls]	151	175	7.2
LRR [sensitive, ls]	176	199	0.74
LRR [sensitive, ls]	176	199	15
LRR [sensitive, ls]	200	223	0.39
LRR [sensitive, ls]	200	223	8
LRR [sensitive, ls]	224	247	0.0037
LRR [sensitive, ls]	224	247	0.077
LRR [sensitive, ls]	248	271	0.02
LRR [sensitive, ls]	248	271	0.42
LRR [sensitive, ls]	272	295	0.27
LRR [sensitive, ls]	272	295	5.5
LRR [sensitive, ls]	296	319	0.023
LRR [sensitive, ls]	296	319	0.47
LRR [sensitive, ls]	320	344	0.28
LRR [sensitive, ls]	320	344	5.9
LRR [sensitive, ls]	351	374	0.035
LRR [sensitive, ls]	351	374	0.72
LRR [sensitive, ls]	375	398	0.0029
LRR [sensitive, ls]	375	398	0.06
LRR [sensitive, ls]	399	422	0.0061
LRR [sensitive, ls]	399	422	0.13
LRR [sensitive, ls]	423	446	0.11
LRR [sensitive, ls]	423	446	2.4
LRR [sensitive, ls]	447	470	0.017
LRR [sensitive, ls]	447	470	0.36
LRR [sensitive, ls]	471	494	0.42
LRR [sensitive, ls]	471	494	8.7
LRR [sensitive, ls]	495	518	0.12
LRR [sensitive, ls]	495	518	2.6
LRR [sensitive, ls]	519	542	0.0016
LRR [sensitive, ls]	519	542	0.034
LRR [sensitive, ls]	543	566	0.29
LRR [sensitive, ls]	543	566	6
LRR [sensitive, ls]	567	589	1.4
LRR [sensitive, ls]	567	589	29
LRR [sensitive, ls]	590	613	2.5
LRR [sensitive, ls]	590	613	51
LRR [sensitive, ls]	614	637	0.72
LRR [sensitive, ls]	614	637	15
LRR [sensitive, ls]	638	661	0.15
LRR [sensitive, ls]	638	661	3.1
LRR [sensitive, ls]	662	685	0.24
LRR [sensitive, ls]	662	685	5
LRR [sensitive, ls]	686	709	0.61
LRR [sensitive, ls]	686	709	13
LRR [sensitive, ls]	710	733	0.09
LRR [sensitive, ls]	710	733	1.9
LRR [sensitive, ls]	734	757	0.011
LRR [sensitive, ls]	734	757	0.23
LRR [sensitive, ls]	758	781	0.0029
LRR [sensitive, ls]	758	781	0.06
LRR [sensitive, ls]	782	806	2.9
LRR [sensitive, ls]	782	806	60
LRR [sensitive, ls]	807	830	0.002
LRR [sensitive, ls]	807	830	0.042
LRR [sensitive, ls]	831	854	0.0043
LRR [sensitive, ls]	831	854	0.089

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	29	560	4e-71
FLS2 [A.thaliana]	34	1262	1e-172
CLV2 [A. thaliana]	44	629	5e-65
Cf-9 [L. pimpinellifolium]	61	873	1e-66
Xa21 [O. sativa]	127	709	3e-72
Xa21 [O. sativa]	204	774	5e-77
CLV2 [A. thaliana]	252	865	6e-65
Xa21 [O. sativa]	296	1058	4e-92
Rpg1 [Hordeum vulgare]	946	1255	2e-16
Rpg1 [Hordeum vulgare]	947	1264	1e-29
Pto [L. esculentum]	949	1255	2e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	887	909	out -> in

Report for 5731.m00074

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)