Report for 5758.m00084

 > 5758.m00084, length: 767, copies: 1 

MSCSFPWGSFCFFLVVLCLPDSNISTSSHGCFVEERTALMDIGSSLTRSNGTAPRSWGRGDDCCLWERVNCSNIT

GRVSHLYFSNLYDSNEVLDAHGHSFWRFDTTVFSSFPELQFLDLSMNNATFQSWDVFESLRNLRELDLSSNRLNG

SIPSLFSLPRLEHLSLSQNLFEGSIPVTPSSNITSALKTFNFSMNNLSGEFSFFWLRNLTKLQKIDVSGNANLVV

AVNFPSWSPSFQLKVLVLSGCNLDKNIVREPIFLRTQHQLEVLDLSNNSLSGSMPNWLFTEQATLVYLNLGNNSL

TGSLGPIWYPQMNLQAISLPMNRISGHLPANISSVFPNMSFLDVSSNTISGEIPSSLCNITRMEYLDLSNNSLSG

ELPNCLLTEYPILTTLKVSNNKLGGPIFGGTNHLSIKHALYLDGNKFEGTLPRYLTADFDAHGTLDLHDNNLSGA

IPNCMTALELDFFIVSHNSLSGHIVPFSFFNSSTVMALDLSHNQFNGNIEWVQYLGESKYLSLGSNKFEGQISPS

LCQLQSLRILDFSHNSLSGPLPSCIGNLSFVQNPVGIPLWSLLCENHFRYPIFDYIGCYEERGFSFRTKGNIYIY

KHNFINWMSGIDLSANMLSGQIPRELGNLGHIKALNLSYNFFAGPIPATFASMSSVESLDLSHNKLSGAIPWQLT

RLSSLSVFSVMYNNLSGCIPNSGQFGSFDMDSYQGNNLLHPASEGSECAPSSGHSLPDDGDGKGNDPILYAVTAA

SFVVTFWITFAFTSFRM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	137	159	0.0031
LRR [Pfam ls]	160	184	4
LRR [Pfam ls]	264	288	0.12
LRR [Pfam ls]	289	311	4.2
LRR [Pfam ls]	338	361	2.8
LRR [Pfam ls]	362	386	0.11
LRR [Pfam ls]	531	554	0.053
LRR [Pfam ls]	631	654	4.4
LRR [Pfam ls]	655	678	0.11

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	137	159	0.00015
LRR [sensitive, ls]	137	159	0.0031
LRR [sensitive, ls]	160	184	0.2
LRR [sensitive, ls]	160	184	4
LRR [sensitive, ls]	186	210	4.1
LRR [sensitive, ls]	186	210	82
LRR [sensitive, ls]	211	233	1.5
LRR [sensitive, ls]	211	233	29
LRR [sensitive, ls]	237	260	3
LRR [sensitive, ls]	237	260	60
LRR [sensitive, ls]	264	288	0.0059
LRR [sensitive, ls]	264	288	0.12
LRR [sensitive, ls]	289	311	0.21
LRR [sensitive, ls]	289	311	4.2
LRR [sensitive, ls]	313	337	2
LRR [sensitive, ls]	313	337	41
LRR [sensitive, ls]	338	361	0.14
LRR [sensitive, ls]	338	361	2.8
LRR [sensitive, ls]	362	386	0.0054
LRR [sensitive, ls]	362	386	0.11
LRR [sensitive, ls]	387	410	2.1
LRR [sensitive, ls]	387	410	43
LRR [sensitive, ls]	459	481	1.2
LRR [sensitive, ls]	459	481	25
LRR [sensitive, ls]	484	506	5.8
LRR [sensitive, ls]	484	506	120
LRR [sensitive, ls]	507	530	2.8
LRR [sensitive, ls]	507	530	57
LRR [sensitive, ls]	531	554	0.0026
LRR [sensitive, ls]	531	554	0.053
LRR [sensitive, ls]	631	654	0.22
LRR [sensitive, ls]	631	654	4.4
LRR [sensitive, ls]	655	678	0.0056
LRR [sensitive, ls]	655	678	0.11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	14	378	2e-12
CLV2 [A. thaliana]	36	727	3e-56
FLS2 [A.thaliana]	68	402	2e-21
Cf-9 [L. pimpinellifolium]	77	712	1e-60
Xa21 [O. sativa]	108	499	1e-31
FLS2 [A.thaliana]	114	714	1e-47
FLS2 [A.thaliana]	114	547	4e-34
Xa21 [O. sativa]	114	378	2e-15
FLS2 [A.thaliana]	117	558	1e-35
FLS2 [A.thaliana]	134	711	6e-54
Xa21 [O. sativa]	140	671	9e-36
Xa21 [O. sativa]	238	697	7e-35
Xa21 [O. sativa]	290	697	1e-30
Cf-9 [L. pimpinellifolium]	313	713	8e-25
Cf-9 [L. pimpinellifolium]	342	697	3e-21
FLS2 [A.thaliana]	605	713	6e-12
Xa21 [O. sativa]	605	713	4e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	743	765	out -> in

Report for 5758.m00084

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)