Report for 5770.m00094

 > 5770.m00094, length: 532, copies: 1 

MQVSKKSRLAAPSALLLLLVVAALLPPPRAEAGHDGAGGDDEPPPTPCSPADRAALLGFKAGVTVDTTGILATWD

GGDDCCGAWEGVSCDAATGRVVALQLEAPPLPPPRRSYMEGALSASLGGLEFLETLVIRDMARIGGAIPASLSRL

SRLKQLYLEGSMLAGGVPGSVLSGMASLQYLSLAGNRFEGKLPPELGSLPGLVQINLAGNRLSGEVPPSYKNLSR

LAYLDLSNNLLSGAIPAFFGQQLKSLAMLDLSNNGFSGEIPASLCGLRNLTDLSLRHNKLTGVIPSQIGSISSLN

SLSIDSNLLVGSIPESLFGLQKLWNLNLSRNGLSGSLPPGIRHGLPSLVSMDLSHNHLVGGIDHFFRSISPARRL

TKNASSDMSVIFLPRQLQHLDLSKNSITGALPEFGAGASLRWLDVSGNAIGGQIPSSVWRLVGLQRLDISRNKIR

GTIPASMASMASLRWLDISGNALVGRIPDSFARMARLRHASFRGNKLCGKIPQARPFNLLPAAAYAGNLCLCGKP

LPPCRQI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	152	176	6.8
LRR [Pfam ls]	177	200	0.0067
LRR [Pfam ls]	201	224	2
LRR [Pfam ls]	225	249	0.25
LRR [Pfam ls]	250	273	0.035
LRR [Pfam ls]	274	297	0.54
LRR [Pfam ls]	298	321	5.7
LRR [Pfam ls]	322	346	2.6
LRR [Pfam ls]	347	370	4.4
LRR [Pfam ls]	391	413	0.49
LRR [Pfam ls]	414	437	1.1
LRR [Pfam ls]	438	461	0.88
LRR [Pfam ls]	462	485	0.079

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	127	151	6.7
LRR [sensitive, ls]	127	151	130
LRR [sensitive, ls]	152	176	0.34
LRR [sensitive, ls]	152	176	6.8
LRR [sensitive, ls]	177	200	0.00033
LRR [sensitive, ls]	177	200	0.0067
LRR [sensitive, ls]	201	224	0.099
LRR [sensitive, ls]	201	224	2
LRR [sensitive, ls]	225	249	0.013
LRR [sensitive, ls]	225	249	0.25
LRR [sensitive, ls]	250	273	0.0017
LRR [sensitive, ls]	250	273	0.035
LRR [sensitive, ls]	274	297	0.027
LRR [sensitive, ls]	274	297	0.54
LRR [sensitive, ls]	298	321	0.28
LRR [sensitive, ls]	298	321	5.7
LRR [sensitive, ls]	322	346	0.13
LRR [sensitive, ls]	322	346	2.6
LRR [sensitive, ls]	347	370	0.22
LRR [sensitive, ls]	347	370	4.4
LRR [sensitive, ls]	391	413	0.025
LRR [sensitive, ls]	391	413	0.49
LRR [sensitive, ls]	414	437	0.053
LRR [sensitive, ls]	414	437	1.1
LRR [sensitive, ls]	438	461	0.044
LRR [sensitive, ls]	438	461	0.88
LRR [sensitive, ls]	462	485	0.0039
LRR [sensitive, ls]	462	485	0.079

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	502	1e-44
CLV2 [A. thaliana]	50	502	2e-44
FLS2 [A.thaliana]	55	501	2e-52
Cf-9 [L. pimpinellifolium]	73	504	8e-35
CLV2 [A. thaliana]	112	294	7e-11
FLS2 [A.thaliana]	112	519	7e-50
Xa21 [O. sativa]	114	523	9e-41
FLS2 [A.thaliana]	116	339	3e-29
Xa21 [O. sativa]	116	315	2e-23
Cf-9 [L. pimpinellifolium]	123	526	6e-36
CLV2 [A. thaliana]	125	315	2e-12
CLV2 [A. thaliana]	126	501	4e-33
CLV2 [A. thaliana]	131	453	2e-28
FLS2 [A.thaliana]	141	529	5e-44
FLS2 [A.thaliana]	181	503	2e-35
Xa21 [O. sativa]	181	502	5e-42
FLS2 [A.thaliana]	202	504	1e-34
FLS2 [A.thaliana]	274	504	1e-19
Xa21 [O. sativa]	389	504	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5770.m00094

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)