Report for 5776.m00018

 > 5776.m00018, length: 1012, copies: 1 

MRGYYCFFHFLVVSVLLHVHGGRSESQTCDPTDMAALLAFSDGLDTKAAGMVGWGPGDAACCSWTGVSCDLGRVV

ALDLSNRSLSRNSLRGGEAVARLGRLPSLRRLDLSANGLAGAFPAGGFPAIEVVNVSSNGFTGPHPAFPGAPNLT

VLDITGNAFSGGINVTALCASPVKVLRFSANAFSGDVPAGFGQCKLLNDLFLDGNGLTGSLPKDLYMMPALRKLS

LQENKLSGSLNDDLGNLTEITQIDLSYNMFNGNIPDVFGKLRSLESLNLASNQLNGTLPLSLSSCPMLRVVSLRN

NSLSGEITIDCRLLTRLNNFDAGTNKLRGAIPPRLASCTELRTLNLARNKLQGELPESFKNLTSLSYLSLTGNGF

TNLSSALQVLQHLPNLTSLVLTNNFRGGETMPMDGIEGFKRMQVLVLANCALLGTVPPWLQSLKSLSVLDISWNN

LHGEIPPWLGNLDSLFYIDLSNNSFSGELPATFTQMKSLISSNGSSGQASTGDLPLFVKKNSTSTGKGLQYNQLS

SFPSSLILSNNKLVGPILPAFGRLVKLHVLDLGFNNFSGPIPDELSNMSSLEILDLAHNDLSGSIPSSLTKLNFL

SKFDVSYNNLSGDIPAGGQFSTFTSEDFAGNHALHFPRNSSSTKNSPDTEAPHRKKNKATLVALGLGTAVGVIFV

LCIASVVISRIIHSRMQEHNPKAVANADDCSESLNSSLVLLFQNNKDLGIEDILKSTNNFDQAYIVGCGGFGLVY

KSTLPDGRRVAIKRLSGDYSQIEREFQAEVETLSRAQHDNLVLLEGYCKIGNDRLLIYAYMENGSLDYWLHERAD

GGALLDWQKRLQIAQGSARGLAYLHLSCEPHILHRDIKSSNILLDENFEAHLADFGLARLICAYETHVTTDVVGT

LGYIPPEYGQSPVATYKGDVYSFGIVLLELLTGRRPVDMCRPKGSRDVVSWVLQMKKEYRETEVFDPTIYDKENE

SQLIRILEIALLCVTAAPKSRPTSQQLVEWLDHIAEG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	124	5.8
LRR [Pfam ls]	148	172	0.59
LRR [Pfam ls]	220	243	0.27
LRR [Pfam ls]	244	267	0.57
LRR [Pfam ls]	268	291	0.69
LRR [Pfam ls]	340	363	0.002
LRR [Pfam ls]	364	386	0.26
LRR [Pfam ls]	416	439	7.7
LRR [Pfam ls]	440	463	0.18
LRR [Pfam ls]	464	487	0.25
LRR [Pfam ls]	551	574	0.041
LRR [Pfam ls]	575	598	0.017
Ser/Thr pkinase [Pfam fs]	735	936	7.7e-45
Ser/Thr pkinase [Pfam ls]	735	1006	1.3e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	124	0.29
LRR [sensitive, ls]	103	124	5.8
LRR [sensitive, ls]	125	147	0.62
LRR [sensitive, ls]	125	147	13
LRR [sensitive, ls]	148	172	0.029
LRR [sensitive, ls]	148	172	0.59
LRR [sensitive, ls]	196	219	0.76
LRR [sensitive, ls]	196	219	15
LRR [sensitive, ls]	220	243	0.013
LRR [sensitive, ls]	220	243	0.27
LRR [sensitive, ls]	244	267	0.028
LRR [sensitive, ls]	244	267	0.57
LRR [sensitive, ls]	268	291	0.034
LRR [sensitive, ls]	268	291	0.69
LRR [sensitive, ls]	292	315	0.85
LRR [sensitive, ls]	292	315	17
LRR [sensitive, ls]	316	339	4.4
LRR [sensitive, ls]	316	339	90
LRR [sensitive, ls]	340	363	0.0001
LRR [sensitive, ls]	340	363	0.002
LRR [sensitive, ls]	364	386	0.013
LRR [sensitive, ls]	364	386	0.26
LRR [sensitive, ls]	390	415	1.7
LRR [sensitive, ls]	390	415	34
LRR [sensitive, ls]	416	439	0.38
LRR [sensitive, ls]	416	439	7.7
LRR [sensitive, ls]	440	463	0.0089
LRR [sensitive, ls]	440	463	0.18
LRR [sensitive, ls]	464	487	0.012
LRR [sensitive, ls]	464	487	0.25
LRR [sensitive, ls]	527	550	2.1
LRR [sensitive, ls]	527	550	43
LRR [sensitive, ls]	551	574	0.002
LRR [sensitive, ls]	551	574	0.041
LRR [sensitive, ls]	575	598	0.00083
LRR [sensitive, ls]	575	598	0.017
LRR [sensitive, ls]	599	621	1.1
LRR [sensitive, ls]	599	621	22

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	7	614	2e-51
FLS2 [A.thaliana]	10	616	6e-57
Xa21 [O. sativa]	33	828	3e-67
Cf-9 [L. pimpinellifolium]	60	615	8e-38
FLS2 [A.thaliana]	67	1006	1e-94
FLS2 [A.thaliana]	70	615	1e-60
Cf-9 [L. pimpinellifolium]	101	697	3e-49
CLV2 [A. thaliana]	152	622	1e-41
CLV2 [A. thaliana]	271	615	3e-31
Rpg1 [Hordeum vulgare]	711	1009	3e-33
Pto [L. esculentum]	725	1008	4e-53
Rpg1 [Hordeum vulgare]	732	1009	1e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	661	683	out -> in

Report for 5776.m00018

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)