Report for 5776.m00021

 > 5776.m00021, length: 942, copies: 1 

MTTRRCLCGALQEMSLLSHFCLCLQRKAGSCCRCIRFLHVFVFVLHIHGGHSQMCDPADQSLLAFSDGLDRMGAG

LVGWGPNDTSCCSWTGISCDLGRVVELDLSNRSLSRNSLRGVAVAQLGRLPCLRRLDLSTNGLVGAFPASGFPAI

EVVNVSSNGFTGPHPAFPGAPNLTVLDITNNAFSGSINVTALCSSPVKILRFSANAFSGDVPAGFSQCKVLNELS

LDSNGLTGSLPKDLYTIPELRVVALDLSNRSLSRNSLRGGEAVARLGRLPSLRRLDLSANGLAGAFPAGGFPAIE

VVNVSSNGFTGPHPAFPGAPNLTVLDITGNAFSGGINVTALCASPVKVLRFSANAFSGDVPAGFGQCKLLNDLFL

DGNCLTGSLPKDLYMMPALRKLSLQENQLSGSLDKALGNLSKLTLIDLSYNMFNGNIPDVFGKLRSLESLNLASN

QLNGTLPLSLSSCPMLRVVSLRNNSLSGEITIDCRLLTRLNNFDAGTNKLRGAIPPRLASCTELRTLNLARNKLQ

GELPESFKNLTSLSYLSLSGNGFTNLSSALQVLQHLPNLTSLVLTNNFRGGETMPMDGIEGFKRMHVLVLANCAL

LGTVPPWLQSLKSLSVLDISWNNLHGEIPPWLGNLDSLFYIDLSNNSFSGELPATFTQMKSSSNGSNGQASTEDL

PLSFVMKDSTSTGKGFQYNQLSSFPPSLILSNNMFVGSILPSFGRLVKLHVLDLGFNNFSGPIPDELSNMSSLEV

LDLAHNDLSGSIPSSLTKLNFLSKFDVSYNNLSGDVPAGGQFSTFTEEEFAGNPSLCRSQSQSCYKRAVTTEMSS

ETRFTFGLFLTVEAGFAFGLLTVWNVLLFASSWRAAYFQMVDNFFDRFIFMLKYWFFGGVVYYSTLGDALLVGGR

RLRWLSAGLGRNLQASFWAVLFSAYLRLWANEGPIQTKSEMA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	127	148	8.3
LRR [Pfam ls]	172	196	0.25
LRR [Pfam ls]	276	297	5.8
LRR [Pfam ls]	321	345	0.59
LRR [Pfam ls]	393	416	0.58
LRR [Pfam ls]	417	440	0.051
LRR [Pfam ls]	441	464	0.69
LRR [Pfam ls]	513	536	0.002
LRR [Pfam ls]	537	559	0.06
LRR [Pfam ls]	613	636	0.18
LRR [Pfam ls]	637	660	0.25
LRR [Pfam ls]	723	746	0.041
LRR [Pfam ls]	747	770	0.0071

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	98	123	3.4
LRR [sensitive, ls]	98	123	68
LRR [sensitive, ls]	127	148	0.41
LRR [sensitive, ls]	127	148	8.3
LRR [sensitive, ls]	149	171	0.62
LRR [sensitive, ls]	149	171	13
LRR [sensitive, ls]	172	196	0.013
LRR [sensitive, ls]	172	196	0.25
LRR [sensitive, ls]	220	243	0.55
LRR [sensitive, ls]	220	243	11
LRR [sensitive, ls]	276	297	0.29
LRR [sensitive, ls]	276	297	5.8
LRR [sensitive, ls]	298	320	0.62
LRR [sensitive, ls]	298	320	13
LRR [sensitive, ls]	321	345	0.029
LRR [sensitive, ls]	321	345	0.59
LRR [sensitive, ls]	369	392	0.92
LRR [sensitive, ls]	369	392	18
LRR [sensitive, ls]	393	416	0.029
LRR [sensitive, ls]	393	416	0.58
LRR [sensitive, ls]	417	440	0.0025
LRR [sensitive, ls]	417	440	0.051
LRR [sensitive, ls]	441	464	0.034
LRR [sensitive, ls]	441	464	0.69
LRR [sensitive, ls]	465	488	0.85
LRR [sensitive, ls]	465	488	17
LRR [sensitive, ls]	489	512	4.4
LRR [sensitive, ls]	489	512	90
LRR [sensitive, ls]	513	536	0.0001
LRR [sensitive, ls]	513	536	0.002
LRR [sensitive, ls]	537	559	0.003
LRR [sensitive, ls]	537	559	0.06
LRR [sensitive, ls]	563	588	1.7
LRR [sensitive, ls]	563	588	34
LRR [sensitive, ls]	589	612	0.62
LRR [sensitive, ls]	589	612	13
LRR [sensitive, ls]	613	636	0.0089
LRR [sensitive, ls]	613	636	0.18
LRR [sensitive, ls]	637	660	0.012
LRR [sensitive, ls]	637	660	0.25
LRR [sensitive, ls]	723	746	0.002
LRR [sensitive, ls]	723	746	0.041
LRR [sensitive, ls]	747	770	0.00035
LRR [sensitive, ls]	747	770	0.0071
LRR [sensitive, ls]	771	793	2
LRR [sensitive, ls]	771	793	40

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	37	650	3e-47
FLS2 [A.thaliana]	53	853	1e-70
Xa21 [O. sativa]	61	653	7e-49
Cf-9 [L. pimpinellifolium]	84	806	5e-58
Xa21 [O. sativa]	92	512	1e-29
Xa21 [O. sativa]	109	605	1e-42
CLV2 [A. thaliana]	171	807	8e-46
Xa21 [O. sativa]	246	807	5e-52
CLV2 [A. thaliana]	325	846	2e-41

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	832	854	out -> in
putative TM domain	875	897	in -> out
putative TM domain	907	929	out -> in

Report for 5776.m00021

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)