Report for 5793.m00340

 > 5793.m00340, length: 1057, copies: 1 

MPPPPPVAAAAAAARHALLLASVAVAVALLLVSPCHGGPLPAASLLPLARSLRTLVLSGTNLTGEIPPELGEYGE

LATLDVSKNQLTGAIPPELCRLSKLESLSLNSNSLRGAIPDDIGNLTALAYLTLYDNELSGAIPASIGNLKRLQV

LRAGGNQGLKGPLPPEIGGCANLTMLGLAETGMSGSLPDTIGQLSRIQTIAIYTTLLSGRIPASIGNCTELTSLY

LYQNSLSGPIPPQLGRLAKLQTLLLWQNQLVGAIPPELGRCRQLTLIDLSLNSLTGSIPATLGDLPNLQQLQLST

NQLTGAIPPELSNCTSLTDVEVDNNQLTGAIAVDFPRLRNLTLFYAWRNRLTGGVPASLAECPSLQAVDLSYNNL

TGVIPKQLFALQNLTKLLLISNELSGPIPPEIGGCGNLYRLRLSVNRLSGTIPAEIGGLKSLNFLDISDNHLVGA

VPSAISGCSSLEFLDLHSNALSGSLPETLPRSLQLIDVSDNQLAGALSSSIGLMPELTKLYLGKNRLAGGIPPEI

GSCQKLQLLDLGDNAFSGVIPPEIGTLPSLEISLNLSCNRLSGEIPSQFAGLEKLGSLDLSHNELSGGLDSLAAL

QNLVTLNISYNAFSGELPDTPFFQRLPLSDLAGNRHLIVGDGSDESSRRGAISSLKVAMSILAAVSAALLVAATY

LLARMRRGGGAGGGGRVVHGEGAWEVTLYQKLDISMDDVLRGLTSANVIGTGSSGVVYKVDTPNGYTFAVKKMWS

TDETTTAAFRSEIAALGSIRHRNIVRLLGWAANGGARLLFYGYLPNGNLSGLLHGGGAAAGKGGAPASDSEWGAR

YDVALGVAHAVAYLHHDCVPAILHGDIKAMNVLLGAAYEPYLADFGLARVLSKLDSAMPAPPRIAGSYGYMAPEY

ASMQRITEKSDVYSFGVVMLEMLTGRHPLDPTLPGGAHLVQWVRDHLQAKRDAAELLDARLRGAAGAGAGADADV

HEMRQAMSVAALCVARRADDRPAMKDVVALLKEIRRPAPSAAGDDAKPPQPTQPPSLPTTVTATPASPVSSCSFA

AVTDYSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	51	74	0.37
LRR [Pfam ls]	75	98	0.18
LRR [Pfam ls]	99	122	0.016
LRR [Pfam ls]	123	146	0.5
LRR [Pfam ls]	220	243	0.81
LRR [Pfam ls]	244	267	3.9
LRR [Pfam ls]	268	291	0.19
LRR [Pfam ls]	292	315	0.009
LRR [Pfam ls]	316	339	4
LRR [Pfam ls]	364	387	0.25
LRR [Pfam ls]	412	435	0.12
LRR [Pfam ls]	436	459	0.26
LRR [Pfam ls]	460	480	0.14
LRR [Pfam ls]	482	505	4.3
LRR [Pfam ls]	506	529	1.2
LRR [Pfam ls]	530	553	0.019
LRR [Pfam ls]	579	601	0.14
LRR [Pfam ls]	602	624	2.9
Ser/Thr pkinase [Pfam fs]	718	930	2.1e-34
Ser/Thr pkinase [Pfam ls]	718	1003	3.1e-26

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	51	74	0.014
LRR [sensitive, ls]	51	74	0.37
LRR [sensitive, ls]	75	98	0.007
LRR [sensitive, ls]	75	98	0.18
LRR [sensitive, ls]	99	122	0.00061
LRR [sensitive, ls]	99	122	0.016
LRR [sensitive, ls]	123	146	0.019
LRR [sensitive, ls]	123	146	0.5
LRR [sensitive, ls]	147	171	0.77
LRR [sensitive, ls]	147	171	20
LRR [sensitive, ls]	172	195	0.83
LRR [sensitive, ls]	172	195	21
LRR [sensitive, ls]	196	219	2.9
LRR [sensitive, ls]	196	219	74
LRR [sensitive, ls]	220	243	0.032
LRR [sensitive, ls]	220	243	0.81
LRR [sensitive, ls]	244	267	0.15
LRR [sensitive, ls]	244	267	3.9
LRR [sensitive, ls]	268	291	0.0075
LRR [sensitive, ls]	268	291	0.19
LRR [sensitive, ls]	292	315	0.00035
LRR [sensitive, ls]	292	315	0.009
LRR [sensitive, ls]	316	339	0.16
LRR [sensitive, ls]	316	339	4
LRR [sensitive, ls]	340	363	0.68
LRR [sensitive, ls]	340	363	17
LRR [sensitive, ls]	364	387	0.0097
LRR [sensitive, ls]	364	387	0.25
LRR [sensitive, ls]	388	411	0.43
LRR [sensitive, ls]	388	411	11
LRR [sensitive, ls]	412	435	0.0046
LRR [sensitive, ls]	412	435	0.12
LRR [sensitive, ls]	436	459	0.01
LRR [sensitive, ls]	436	459	0.26
LRR [sensitive, ls]	460	480	0.0053
LRR [sensitive, ls]	460	480	0.14
LRR [sensitive, ls]	482	505	0.17
LRR [sensitive, ls]	482	505	4.3
LRR [sensitive, ls]	506	529	0.047
LRR [sensitive, ls]	506	529	1.2
LRR [sensitive, ls]	530	553	0.00074
LRR [sensitive, ls]	530	553	0.019
LRR [sensitive, ls]	554	578	0.84
LRR [sensitive, ls]	554	578	21
LRR [sensitive, ls]	579	601	0.0053
LRR [sensitive, ls]	579	601	0.14
LRR [sensitive, ls]	602	624	0.11
LRR [sensitive, ls]	602	624	2.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	20	622	5e-94
Xa21 [O. sativa]	37	308	2e-34
Cf-9 [L. pimpinellifolium]	38	452	2e-36
CLV2 [A. thaliana]	38	550	6e-49
Xa21 [O. sativa]	38	476	5e-62
Cf-9 [L. pimpinellifolium]	43	634	1e-63
Cf-9 [L. pimpinellifolium]	52	597	3e-47
FLS2 [A.thaliana]	52	1019	1e-137
Xa21 [O. sativa]	55	804	2e-86
CLV2 [A. thaliana]	74	639	1e-65
FLS2 [A.thaliana]	74	618	9e-91
FLS2 [A.thaliana]	104	618	5e-80
Xa21 [O. sativa]	221	620	1e-58
Xa21 [O. sativa]	480	619	1e-16
Rpg1 [Hordeum vulgare]	711	1009	6e-27
Rpg1 [Hordeum vulgare]	711	1019	1e-15
Pto [L. esculentum]	724	1003	1e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5793.m00340

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)