Report for 5809.m00150

 > 5809.m00150, length: 930, copies: 2 

MVKRRLFLLLFLCLLAGSRIASADTNPQDAAALRSLMKKWTKNVPASWRKSNDPCARWDGITCDRNSRVTSLNLF

GMNLEGTLSDDIGNLTELTVLDLSSNRGVGGTLTPAIGKLANLRILALIGCSFSGNVPSELGNLSQLDFLGLNSN

QFTGKIPPSLGKLSKVTWLDLADNQLTGPIPNSRDHGSGFDQLLKAQHFHLNKNKLQGSVPDFLFNSSMDLKHIL

FDRNNFNGSIPASIGVLPKLEVLRLNDNAFTGPVPAMNNLTKLHVLMLSNNKLSGLMPNLTGMDMLENVDLSNNS

FIPSEVPSWFTSLIKLMTLKMQSVGLSGQLPQKLFSNPNLQYVVLSDNQLNGVLDMGNISDELHVDICYFSVARL

AGNPVCGDSLLSSMKPCTDLTTEPLHKPPSIDVQCANPFVETIVFRAPSFGDVVKFLPSLQANLSSKLNSCTPNN

LGLVYSNDDAYLNVDIRACPVNQKRFNYSQVLNCFNLTLQTYKPPEIFGPYYVKAHPYPFHDKTSRAVLIGVVTG

SLLLVIGLTLVGVYAVRQKKRAQKLVSINDPFASWGSMGQDIGEAPKIKSARCFTLEDLKLSTNDFREINAIGAG

GYGTVYRGKLPDGQLIAIKRSKQGSMQGGLEFKTEIELLSRVHHKNLVGLVGFCFEKGERMLVYEFIPNGTLSEA

LYGIKGVQLDWSRRLKIALDSARGLAYLHDHADPPIIHRDVKSTNILLDERMTAKVADFGLSLLVSDSEEGQFCT

NVKGTLGYLDPEYYMTQQLTAKSDVYSFGVVLLELIVAQPPIHKQKYIVREVKTALDMGDQTYCGLKDVMDPVLQ

KTGDLRGFARFLKLALQCVEDLGTDRPSMNTIVREIEVIMQDNGIRTGMSSTSSSFSIDSRTMMAAPKYPYSNAS

TSSTAFDMDSRAFEYSGKFPSEGSLKNRGT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	68	91	4.3
LRR [Pfam ls]	92	116	5.2
LRR [Pfam ls]	141	164	0.5
LRR [Pfam ls]	165	184	6.8
LRR [Pfam ls]	244	266	0.5
LRR [Pfam ls]	267	286	0.15
Ser/Thr pkinase [Pfam fs]	591	785	1e-48
Ser/Thr pkinase [Pfam ls]	591	863	1.1e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	68	91	0.16
LRR [sensitive, ls]	68	91	4.3
LRR [sensitive, ls]	92	116	0.19
LRR [sensitive, ls]	92	116	5.2
LRR [sensitive, ls]	117	140	0.34
LRR [sensitive, ls]	117	140	9.2
LRR [sensitive, ls]	141	164	0.018
LRR [sensitive, ls]	141	164	0.5
LRR [sensitive, ls]	165	184	0.25
LRR [sensitive, ls]	165	184	6.8
LRR [sensitive, ls]	195	218	1.1
LRR [sensitive, ls]	195	218	31
LRR [sensitive, ls]	220	243	0.39
LRR [sensitive, ls]	220	243	11
LRR [sensitive, ls]	244	266	0.018
LRR [sensitive, ls]	244	266	0.5
LRR [sensitive, ls]	267	286	0.0054
LRR [sensitive, ls]	267	286	0.15
LRR [sensitive, ls]	290	314	0.6
LRR [sensitive, ls]	290	314	16
LRR [sensitive, ls]	339	360	0.6
LRR [sensitive, ls]	339	360	16
LRR [sensitive, ls]	580	601	3.6
LRR [sensitive, ls]	580	601	98

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	6	367	1e-30
CLV2 [A. thaliana]	7	356	7e-26
Xa21 [O. sativa]	27	352	3e-24
Cf-9 [L. pimpinellifolium]	47	352	4e-26
FLS2 [A.thaliana]	58	363	1e-32
Cf-9 [L. pimpinellifolium]	64	332	1e-13
Xa21 [O. sativa]	65	367	2e-25
Cf-9 [L. pimpinellifolium]	67	366	9e-18
CLV2 [A. thaliana]	68	301	3e-15
FLS2 [A.thaliana]	69	861	5e-75
CLV2 [A. thaliana]	71	354	8e-20
CLV2 [A. thaliana]	72	354	5e-28
Cf-9 [L. pimpinellifolium]	78	361	4e-16
CLV2 [A. thaliana]	79	415	3e-15
FLS2 [A.thaliana]	79	361	6e-23
Xa21 [O. sativa]	79	285	1e-17
Rpg1 [Hordeum vulgare]	577	864	2e-37
Pto [L. esculentum]	579	866	1e-53
Rpg1 [Hordeum vulgare]	579	864	3e-27

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	517	539	out -> in

Report for 5809.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)