Report for 5809.m00152

 > 5809.m00152, length: 1148, copies: 2 

MARKIKDIKVKYNEIVRQRRDANTIRSSLQVDQPIPSSNMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNE

GENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVR

EISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLF

LKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSY

IHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPMKEEQPKDIASEYFDSLVKAGFFLQDTIEEFGYLH

KMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCY

IRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLE

LNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLS

NCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKL

RCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDW

SRGETEKELVTDMVMEQDLAVLNALEPPSRIEEILIYYYGGPCLPWWMKKQTDSSCWESTMLKQTNPCQLIYLTR

MTLHEIPNLKHMQGLVELPLLNYLELFGLPNLEDMWTTTGGAEIRGDELQAKYCFPALSTLWIRGCPRLNVVPYF

PSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNI

FGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACD

NLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNLV

KRCEQEVGEDWQLVSHIPNLISD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam fs]	40	343	4e-52
NB-ARC [Pfam ls]	40	343	5.9e-52
LRR [Pfam ls]	593	615	3.1
LRR [Pfam ls]	663	686	0.56
LRR [Pfam ls]	1041	1063	3.5
LRR [Pfam ls]	1064	1087	0.039

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	496	519	1.4
LRR [sensitive, ls]	496	519	37
LRR [sensitive, ls]	520	543	1.3
LRR [sensitive, ls]	520	543	34
LRR [sensitive, ls]	544	567	0.92
LRR [sensitive, ls]	544	567	25
LRR [sensitive, ls]	568	592	0.39
LRR [sensitive, ls]	568	592	10
LRR [sensitive, ls]	593	615	0.12
LRR [sensitive, ls]	593	615	3.1
LRR [sensitive, ls]	616	638	0.41
LRR [sensitive, ls]	616	638	11
LRR [sensitive, ls]	639	662	0.31
LRR [sensitive, ls]	639	662	8.3
LRR [sensitive, ls]	663	686	0.021
LRR [sensitive, ls]	663	686	0.56
LRR [sensitive, ls]	969	992	1.2
LRR [sensitive, ls]	969	992	32
LRR [sensitive, ls]	993	1016	1.6
LRR [sensitive, ls]	993	1016	42
LRR [sensitive, ls]	1017	1040	1.5
LRR [sensitive, ls]	1017	1040	40
LRR [sensitive, ls]	1041	1063	0.13
LRR [sensitive, ls]	1041	1063	3.5
LRR [sensitive, ls]	1064	1087	0.0014
LRR [sensitive, ls]	1064	1087	0.039
LRR [sensitive, ls]	1112	1140	0.87
LRR [sensitive, ls]	1112	1140	24

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Mla1 [Hordeum vulgare].	1	670	5e-35
Xa1 [Oryza sativa]	13	583	8e-48
N [N. glutinosa]	17	688	7e-23
I2 [L. esculentum]	52	1143	4e-63
Pib [Oryza sativa].	52	546	2e-30
RPS2 [A. thaliana]	55	653	5e-30
Pi-ta [Oryza sativa]	59	574	4e-24
M [L. usitatissimum]	60	1124	1e-19
L6 [L. usitatissimum]	73	1124	6e-18
RPP5 [A. thaliana]	75	1081	7e-15
RPM1 [A. thaliana]	81	700	2e-40
RPP5 [A. thaliana]	457	689	1e-12
RPP5 [A. thaliana]	485	713	1e-10
RPP5 [A. thaliana]	608	1124	1e-20
Xa1 [Oryza sativa]	630	1121	5e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5809.m00152

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)