Report for 5823.m00087

 > 5823.m00087, length: 1101, copies: 1 

MLSVVVLLLLAAALPMSCSNDTDLTALLAFRAQVSDPLGILRVNWTTGTSFCSWIGVSCSHHRRRRRAVAALELP

NIPLHGMVTPHLGNLSFLSFINLTNTGLEGPIPDDLGRLTRLRVLDLSRNRLSGSVPSSIGNLTRIQVLVLSYNN

LSGHILTELGNLHDIRYMSFIKNDLSGNIPENIFNNTPLLTYINFGNNSLSGSIPDGIGSSLPNLEYLCLHVNQL

EGPVPPSIFNKSRLQELFLWGNYKLTGPIPDNGSFSLPMLRWIDLHWNSFRGQIPTGLAACRHLERINLIHNSFT

DVLPTWLAKLPKLIVIALGNNNIFGPIPNVLGNLTGLLHLELAFCNLTGVIPPGLVHMRKLSRLHLSHNQLTGPF

PAFVGNLTELSFLVVKSNSLTGSVPATFGNSKALNIVSIGWNLLHGGLDFLPTLSNCRQLQTLDISNSFFTGNLP

DYMGNFSNQLVIFFAFGNQLTGGIPASLSNLSALNLLDLSNNQMSNIIPESIMMLKNLRMLDFSGNSLSGPIPTE

ISALNSLERLLLHDNKLSGVLPLGLGNLTNLQYISLSNNQFFSVIPPSIFHLNYLLVINMSHNSLTGLLPLPDDI

SSLTQINQIDLSANHLFGSLPASLGKLQMLTYLNLSYNMFDDSIPDSFRKLSNIAILDLSSNNLSGRIPSYFANL

TYLTNVNFSFNNLQGQVPEGGVFLNITMQSLMGNPGLCGASRLGLSPCLGNSHSAHAHILKFVFPAIVAVGLVVA

TCLYLLSRKKNAKQREVIMDSAMMVDAVSHKIISYYDIVRATDNFSEQNLLGSGSFGKVYKGQLSDNLVVAIKVL

NMQLEEATRSFDSECRVLRMARHRNLMRILNTCSNLDFRALLLEFMPNGSLQKHLHSEGMPRLGFLKRLDTMLDV

SMAMDYLHNQHYEVVLHCDLKPSNVLFDDEMTAHVADFGIAKLLLGDESSMVSVSMLGTIGYMAHEYCSMAKASR

KSDVFSYGIMLLEVFTGKMPTDPMFAGELSLREWVHQAFPLRLTDVVDSNLLQDCDKDCGTNHNDNAHEDAASSR

LITDLLVPIFEVGLMCCSHAPDERPTMKDVVVKLERIKRDYADSTGSQRTE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	92	115	4.7
LRR [Pfam ls]	116	139	0.0012
LRR [Pfam ls]	140	163	1.2
LRR [Pfam ls]	189	213	0.38
LRR [Pfam ls]	288	311	0.97
LRR [Pfam ls]	312	335	1.9
LRR [Pfam ls]	336	359	2
LRR [Pfam ls]	360	383	0.079
LRR [Pfam ls]	434	457	3.6
LRR [Pfam ls]	483	506	0.47
LRR [Pfam ls]	507	530	0.12
LRR [Pfam ls]	531	554	0.17
LRR [Pfam ls]	555	578	0.085
LRR [Pfam ls]	629	652	0.13
LRR [Pfam ls]	653	676	0.0065
Ser/Thr pkinase [Pfam fs]	795	997	2.2e-46
Ser/Thr pkinase [Pfam ls]	795	1081	1.3e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	92	115	0.23
LRR [sensitive, ls]	92	115	4.7
LRR [sensitive, ls]	116	139	5.9e-05
LRR [sensitive, ls]	116	139	0.0012
LRR [sensitive, ls]	140	163	0.058
LRR [sensitive, ls]	140	163	1.2
LRR [sensitive, ls]	164	188	2.4
LRR [sensitive, ls]	164	188	49
LRR [sensitive, ls]	189	213	0.018
LRR [sensitive, ls]	189	213	0.38
LRR [sensitive, ls]	214	237	0.96
LRR [sensitive, ls]	214	237	20
LRR [sensitive, ls]	238	263	0.56
LRR [sensitive, ls]	238	263	12
LRR [sensitive, ls]	264	287	1
LRR [sensitive, ls]	264	287	21
LRR [sensitive, ls]	288	311	0.047
LRR [sensitive, ls]	288	311	0.97
LRR [sensitive, ls]	312	335	0.09
LRR [sensitive, ls]	312	335	1.9
LRR [sensitive, ls]	336	359	0.098
LRR [sensitive, ls]	336	359	2
LRR [sensitive, ls]	360	383	0.0038
LRR [sensitive, ls]	360	383	0.079
LRR [sensitive, ls]	384	407	1.3
LRR [sensitive, ls]	384	407	27
LRR [sensitive, ls]	434	457	0.17
LRR [sensitive, ls]	434	457	3.6
LRR [sensitive, ls]	459	482	0.47
LRR [sensitive, ls]	459	482	9.6
LRR [sensitive, ls]	483	506	0.023
LRR [sensitive, ls]	483	506	0.47
LRR [sensitive, ls]	507	530	0.0056
LRR [sensitive, ls]	507	530	0.12
LRR [sensitive, ls]	531	554	0.008
LRR [sensitive, ls]	531	554	0.17
LRR [sensitive, ls]	555	578	0.0041
LRR [sensitive, ls]	555	578	0.085
LRR [sensitive, ls]	579	604	0.56
LRR [sensitive, ls]	579	604	12
LRR [sensitive, ls]	605	628	0.42
LRR [sensitive, ls]	605	628	8.7
LRR [sensitive, ls]	629	652	0.0061
LRR [sensitive, ls]	629	652	0.13
LRR [sensitive, ls]	653	676	0.00031
LRR [sensitive, ls]	653	676	0.0065
LRR [sensitive, ls]	677	699	1.8
LRR [sensitive, ls]	677	699	37

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	2	621	2e-75
CLV2 [A. thaliana]	7	713	2e-65
Cf-9 [L. pimpinellifolium]	8	714	8e-61
FLS2 [A.thaliana]	19	694	7e-88
FLS2 [A.thaliana]	72	1101	1e-148
Xa21 [O. sativa]	218	883	1e-106
FLS2 [A.thaliana]	293	709	7e-53
CLV2 [A. thaliana]	333	714	3e-34
Rpg1 [Hordeum vulgare]	768	993	1e-25
Pto [L. esculentum]	787	1085	1e-33
Rpg1 [Hordeum vulgare]	792	993	3e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	737	756	out -> in

Report for 5823.m00087

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)